Ncuti Gatwa

Ncuti Gatwa
30. august 2024
Personlig information
FødtMizero Ncuti Gatwa Rediger på Wikidata
15. oktober 1992 (32 år) Rediger på Wikidata
Kigali, Rwanda Rediger på Wikidata
BopælLondon Rediger på Wikidata
Uddannelse og virke
Uddannelses­stedRoyal Conservatoire of Scotland (til 2013),
Boroughmuir High School,
Dunfermline High School, Dunfermline Rediger på Wikidata
BeskæftigelseTv-skuespiller, teaterskuespiller, skuespiller Rediger på Wikidata
Information med symbolet Billede af blyant hentes fra Wikidata. Kildehenvisninger foreligger sammesteds.


Mizero Ncuti Gatwa[1] (født 15. oktober 1992) er en rwandiansk-skotsk skuespiller.[2][3] Han begyndte sin scenekarriere på Dundee Repertory Theatre, og han blev nomineret til en Ian Charleson Award for sin præstation som Mercutio i opsætningen af Romeo & Juliet i 2014 på HOME.

Gatwas gennembrud i tv kom i rollen som Eric Effiong i Netflix dramaserie Sex Education (2019–2023), som gav ham en BAFTA Scotland Award og tre nomineringer til BAFTA Television Award. Han blev yderligere kendt i rollen som den femtende inkarnation af Doktoren i BBC/Disney+ science fiction-serien Doctor Who (2023–nu), og han har medvirket i film som Barbie (2023) og tv-serien Masters of the Air (2024).

Filmografi

Film

År Titel Rolle Noter
2019 Horrible Histories: The Movie – Rotten Romans Timidius
2021 The Last Letter from Your Lover Nick
2023 Barbie Kunstner-Ken
2025 The Roses Filmer

Tv

År Titel Rolle Noter Ref.
2014 Bob Servant Male Customer Episode: "The Van" [4]
2015 Stonemouth Dougie 2 episoder [5]
2019–2023 Sex Education Eric Effiong Main role, 32 episoder [6]
2023 An Adventure in Space and Time Den femtende Doktor Cameo ; re-edit of 2013 film [7]
2023–nu Doctor Who Hovedrolle [8]
2024 Masters of the Air 2nd Lt. Robert Daniels Miniseries [9]
Tales of the TARDIS Fifteenth Doctor Episode: "Pyramids of Mars"

Teater

År Titel Rolle Venue Ref.
2013 Victoria Gavin/Callum/Patrick Dundee Rep [10]
Hecuba Polydorus [11]
The BFG Sam/Head of Army/Childchewer [12]
2014 And Then There Were None Anthony James Marston [13]
Cars and Boys Robert [14]
Woman in Mind Tony Dundee Rep / Birmingham Rep [15]
Romeo & Juliet Mercutio HOME [16]
2015 Shakespeare in Love Wabash Noël Coward Theatre [17]
Lines Valentine The Yard Theatre [18]
2015–2017 946: The Amazing Story of Adolphus Tips Adolphus Shakespeare's Globe [19]
2016 A Midsummer Night's Dream Demetrius [20]
2017 Trouble in Mind John Nevins Print Room at the Coronet [21]
2017–2018 The Claim Serge Crucible Theatre [22]
2018 The Rivals Captain Jack Absolute Watermill Theatre [23]
2024–2025 The Importance of Being Earnest Algernon Moncrief Lyttleton Theatre, National Theatre, London [24]

Hørespil

År Titel Rolle Production Noter Ref.
2022 Lusus Christopher BBC Radio 4 Episode: "Khar Darakh" [25]
2023 David Copperfield David Copperfield Audible [26]

Computerspil

År Titel Rolle Noter Ref.
2022 Grid Legends Valentin Manzi Voice and motion capture [27]

Referencer

  1. ^ The cast of Sex Education (2020). The Cast Of 'Sex Education' Takes The BFF Test (Video). BuzzFeed Celeb. Arkiveret fra originalen 20. marts 2020. Hentet 24. december 2020 – via YouTube.
  2. ^ "Black and Scottish — 'I thought I was the only black person in the world'". BBC. 9. maj 2022. Arkiveret fra originalen 12. juli 2022. Hentet 8. august 2022.
  3. ^ Jane McLeod (9. maj 2022). "Who is Ncuti Gatwa? Meet the Rwandan-Scottish actor taking over as Doctor Who". The National (Scotland). Arkiveret fra originalen 9. maj 2022. Hentet 20. november 2022.
  4. ^ "Ncuti Gatwa: A Timelord making history". Royal Television Society (engelsk). 8. juni 2022. Arkiveret fra originalen 19. december 2022. Hentet 18. december 2022.
  5. ^ "Educating Ncuti". Review (engelsk). 3. december 2019. Arkiveret fra originalen 19. december 2022. Hentet 18. december 2022.
  6. ^ Lockett, Dee (22. januar 2019). "Sex Education's Ncuti Gatwa Doesn't Want to Play the Gay Best Friend". Vulture. Arkiveret fra originalen 8. november 2020. Hentet 20. februar 2019.
  7. ^ "Doctor Who's Ncuti Gatwa appears in revamped An Adventure in Space and Time". Radio Times (britisk engelsk). Hentet 23. november 2023.
  8. ^ Belam, Martin (8. maj 2022). "Doctor Who: Ncuti Gatwa to replace Jodie Whittaker, BBC announces". The Guardian. Arkiveret fra originalen 8. maj 2022. Hentet 9. maj 2022.
  9. ^ "Ncuti Gatwa – Curtis Brown". Arkiveret fra originalen 8. maj 2022. Hentet 15. maj 2022.
  10. ^ "Theatre review: Victoria, Dundee Rep". 9. september 2013. Arkiveret fra originalen 8. maj 2022. Hentet 15. maj 2022.
  11. ^ "Hecuba Dundee Rep". 21. oktober 2013. Arkiveret fra originalen 21. maj 2022. Hentet 15. maj 2022.
  12. ^ "The BFG". Arkiveret fra originalen 12. oktober 2022. Hentet 15. maj 2022.
  13. ^ Radcliffe, Allan. "And Then There Were None, Dundee Rep". Arkiveret fra originalen 12. oktober 2022. Hentet 15. maj 2022.
  14. ^ "Cars and Boys review – A dreamlike play that never ceases to grip". TheGuardian.com. 22. april 2014. Arkiveret fra originalen 15. maj 2022. Hentet 15. maj 2022.
  15. ^ "Photo Flash: First Look at Birmingham Repertory Theatre's WOMAN IN MIND, Opening Tonight". Arkiveret fra originalen 15. maj 2022. Hentet 15. maj 2022.
  16. ^ "Review: Romeo & Juliet @ Victoria Baths". 18. september 2014. Arkiveret fra originalen 15. maj 2022. Hentet 15. maj 2022.
  17. ^ "New Cast to Take Over in West End's Shakespeare in Love". Arkiveret fra originalen 15. maj 2022. Hentet 15. maj 2022.
  18. ^ "Lines Review, Yard Theatre". Arkiveret fra originalen 12. oktober 2022. Hentet 15. maj 2022.
  19. ^ "'946: The Amazing Story of Adolphus Tips' at Berkeley Rep". 12. december 2016. Arkiveret fra originalen 23. maj 2022. Hentet 15. maj 2022.
  20. ^ "SHAKESPEARE, W.: Midsummer Night's Dream (A) (Shakespeare's Globe, 2016) (NTSC)". Arkiveret fra originalen 15. maj 2022. Hentet 15. maj 2022.
  21. ^ "Trouble in Mind, The Print Room review – Tanya Moodie is a treat to watch". 22. september 2017. Arkiveret fra originalen 12. oktober 2022. Hentet 15. maj 2022.
  22. ^ "Cast Complete for THE CLAIM UK Tour". Broadwayworld.com. Arkiveret fra originalen 15. maj 2022. Hentet 15. maj 2022.
  23. ^ "The Rivals". jonathanhumphreys.com. Arkiveret fra originalen 28. maj 2022. Hentet 15. maj 2022.
  24. ^ Wiegand, Chris (29. april 2024). "Ncuti Gatwa cast in National Theatre production of The Importance of Being Earnest". The Guardian (britisk engelsk). ISSN 0261-3077. Hentet 29. april 2024.
  25. ^ "Lusus". BBC Radio 4 (britisk engelsk). Arkiveret fra originalen 19. december 2022. Hentet 18. december 2022.
  26. ^ Wiseman, Andreas (16. august 2023). "Ncuti Gatwa, Helena Bonham Carter, Theo James, Jessie Buckley, Richard Armitage, Jack Lowden & Indira Varma Set For Sam Mendes Audible Update Of 'David Copperfield'". Deadline (amerikansk engelsk). Arkiveret fra originalen 18. august 2023. Hentet 18. august 2023.
  27. ^ "Man. Machine – Ncuti Gatwa Takes Players Inside The Mind Of A Grid Legend". Electronic Arts Inc. (engelsk). 20. januar 2022. Arkiveret fra originalen 25. september 2023. Hentet 18. december 2022.

Eksterne henvisninger

Read other articles:

Найба47°26′37″ пн. ш. 142°45′22″ сх. д. / 47.44384900002777528° пн. ш. 142.75617200002776030° сх. д. / 47.44384900002777528; 142.75617200002776030Витік Гирло Затока Терпіння (Охотське море)• координати 47°26′37″ пн. ш. 142°45′22″ сх. д. / 47.44384900002777528° пн. ш. 142.75617200002776030�...

Kosovo Kapitän Jeton Hadergjonaj Aktuelles ITF-Ranking 129 Statistik Erste Teilnahme 2016 Davis-Cup-Teilnahmen 6 Bestes Ergebnis Europa Gruppenzone III(2016–2018) Ewige Bilanz 1:20 Erfolgreichste Spieler Meiste Siege gesamt Granit Bajraliju (4) Meiste Einzelsiege Granit Bajraliju (3) Meiste Doppelsiege Granit Bajraliju, Genc Selita (je 1) Bestes Doppel Granit Bajraliju, Genc Selita (je 1) Meiste Teilnahmen Granit Bajraliju (19) Meiste Jahre Granit Bajraliju (6) Letzte Aktualisierung der In...

C. V. Raman Chandrasekhara Venkata Raman (चन्द्रशेखर वेङ्कट रामन्) (7 November 1888-21 November 1970) merupakan fisikawan India. Ia dilahirkan di Tiruchirapalli, Tamil Nadu. Dalam usia awal Raman pindah ke kota Visakhapatnam, Andhra Pradesh. Ia menamatkan BA and MA dalam Fisika dan Bahasa Inggrisnya dari Perguruan Tinggi Kepresidenan, Madras (kini Chennai). Ia menjadi anggota Pamong Praja India sebagai Asisten Jenderal Akuntan di Calcutta (kini Kolkat...

هذه المقالة تحتاج للمزيد من الوصلات للمقالات الأخرى للمساعدة في ترابط مقالات الموسوعة. فضلًا ساعد في تحسين هذه المقالة بإضافة وصلات إلى المقالات المتعلقة بها الموجودة في النص الحالي. (سبتمبر 2021) هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة...

1990 studio album by No Use for a NameIncognitoStudio album by No Use for a NameReleasedNovember 16, 1990RecordedSeptember 3–8, 1990StudioWestbeach Recorders, Hollywood, CaliforniaGenreHardcore punk[1]Length33:47LabelNew Red ArchivesProducerBrett GurewitzNo Use for a Name chronology Let 'Em Out!(1990) Incognito(1990) Don't Miss the Train(1992) Professional ratingsReview scoresSourceRatingAllMusic[1] Incognito is the debut album by No Use for a Name.[2] It was...

My Life in RuinsBerkas:MyLifeInRuinsPoster.jpgTheatrical release posterSutradara Donald Petrie Produser Michelle Chydzik Nathalie Marciano Ditulis oleh Mike Reiss PemeranNia VardalosRichard DreyfussAlexis GeorgoulisHarland WilliamsPenata musikDavid NewmanDavid MullenSinematograferJosé Luis AlcainePenyuntingPatrick J. Don VitoPerusahaanproduksi26 Films PlaytoneDistributorSearchlight Pictures Echo Bridge EntertainmentHollywood EntertainmentTanggal rilis 7 Mei 2009 (2009-05-07) (...

Peta Vizcaya menunjukkan lokasi Elorrio Elorrio merupakan nama kota di Spanyol. Letaknya di bagian utara. Tepatnya di Wilayah Otonomi Pais Vasco, Provinsi Vizcaya, Spanyol. Pada tahun 2005, kota ini memiliki jumlah penduduk sebanyak 7.094 jiwa (2005) dan memiliki luas wilayah 37,40 km². Kota ini terletak 39 km dari Bilbao. Artikel bertopik geografi atau tempat Spanyol ini adalah sebuah rintisan. Anda dapat membantu Wikipedia dengan mengembangkannya.lbs

E2F

Family of transcription factors E2F is a group of genes that encodes a family of transcription factors (TF) in higher eukaryotes. Three of them are activators: E2F1, 2 and E2F3a. Six others act as suppressors: E2F3b, E2F4-8. All of them are involved in the cell cycle regulation and synthesis of DNA in mammalian cells. E2Fs as TFs bind to the TTTCCCGC (or slight variations of this sequence) consensus binding site in the target promoter sequence. E2F family Schematic diagram of the amino acid s...

Nitronatrit Kleine, weiße Nitronatrit-Kristalle, bedeckt mit hellbraunem Ton (Größe: 8,1 cm × 6,1 cm) Allgemeines und Klassifikation IMA-Nummer 1980 s.p.[1] IMA-Symbol Ntt[2] Andere Namen Chilesalpeter Natriumnitrat Natronsalpeter Nitratin Chemische Formel Na[NO3][3] Mineralklasse(und ggf. Abteilung) Carbonate und Nitrate (ehemals Carbonate, Nitrate und Borate) System-Nummer nach Strunz (8. Aufl.) Lapis-Systematik(nach Strunz und Weiß) Str...

StabatKecamatanKantor Kecamatan StabatStabatPeta lokasi Kecamatan StabatTampilkan peta IndonesiaStabatStabat (Indonesia)Tampilkan peta IndonesiaKoordinat: 3°44′37″N 98°26′46″E / 3.743670°N 98.446220°E / 3.743670; 98.446220Negara IndonesiaProvinsiSumatera UtaraKabupatenLangkatPemerintahan • CamatNuriadi, S.Sos[1]Populasi (2021)[2] • Total93.063 jiwa • Kepadatan857/km2 (2,220/sq mi)Kode pos208...

Charakteristische Landschaft in den Dombes mit Fischteichen Dombes (im Französischen sowohl Les Dombes als auch La Dombes, Arpitan: La Domba) ist eine Landschaft in Ostfrankreich, im Frühmittelalter Teil der Provinz Burgund, heute Teil des Départements Ain in der Region Auvergne-Rhône-Alpes. Inhaltsverzeichnis 1 Geographie 2 Geschichte 3 Gemeinden in den Dombes 4 Siehe auch 5 Weblinks Geographie Die Dombes werden im Westen von der Saône, im Süden von der Rhône, im Osten vom Ain und im ...

مبنى الإذاعة والتلفزيون المصريالتسميةنسبة الاسم إلى جاستون ماسبيرو معلومات عامةنوع المبنى مبنى المنطقة الإدارية محافظة القاهرة البلد  مصر معلومات أخرىالإحداثيات 30°03′12″N 31°13′51″E / 30.0533°N 31.2308°E / 30.0533; 31.2308 تعديل - تعديل مصدري - تعديل ويكي بيانات 30°03′12″N 31°13...

2016–17 concert tour by Green Day Revolution Radio TourTour by Green DayPromotional poster for the tourAssociated albumRevolution RadioStart dateSeptember 26, 2016 (2016-09-26)End dateNovember 19, 2017 (2017-11-19)Legs8No. of shows120Green Day concert chronology 99 Revolutions Tour(2013) Revolution Radio Tour(2016–17) Hella Mega Tour(2021–22) The Revolution Radio Tour was a concert tour by American rock band Green Day in support of the group's twelfth studi...

Not to be confused with Maryino District. District in federal city of Moscow, RussiaMaryina Roshcha District район Марьина рощаDistrictStreet in Maryina Roshcha District FlagCoat of armsLocation of Maryina Roshcha District in Moscow (pre-2012 map)Coordinates: 55°48′N 37°37′E / 55.800°N 37.617°E / 55.800; 37.617CountryRussiaFederal subjectfederal city of Moscow[1]Population (2010 Census)[2] • Total65,973 •&...

Peace treaty which ended the First Punic War Treaty of LutatiusTypePeace TreatyContextTreaty to end the First Punic War between Carthage and RomeDrafted241 BCSigned241 BCWith a codicil added in 237 BCMediators Hamilcar Barca Gaius Lutatius Catulus Negotiators Gisco Gaius Lutatius Catulus Quintus Lutatius Cerco Parties Carthage Rome vteFirst Punic War Treaties Messana Agrigentum 1st Mytistratus Lipari Islands Mylae Thermae 2nd Mytistratus Sulci Tyndaris Cape Ecnomus Aspis Adys Bagradas (Tunis)...

Indian dynasty (c. 225 – c.340) For other uses, see Ikshvaku (disambiguation). Ikshvakus of VijayapuriEarly 3rd century–early 4th centurySouth Asia350 CEYAUDHEYASARJUNAYANASMADRAKASMALAVASIKSHVAKUSKALABHRASWESTERNGANGASTOCHARIANSKADAMBASPALLAVASLITTLEKUSHANSLICCHAVISWESTERNSATRAPSSASANIANHINDMAHAMEGHA-VAHANASKAMARUPAGAUDASAMATATASDAVAKAKIDARITESABHIRASVAKATAKASGUPTAEMPIREKUSHANO-SASANIANSSAKASTANTURANMAKRANSASANIANEMPIRE  ◁ ▷ Location of the Andhra Ikshvakus in c. 350 CECapitalVi...

Indian historian (born 1931) Romila ThaparThapar in 2016Born (1931-11-30) 30 November 1931 (age 92)Lucknow, United Provinces, British IndiaAlma materPanjab University SOAS University of London (PhD) Occupation(s)Historian, WriterKnown forAuthoring books about Indian historyParentDaya Ram Thapar (father)RelativesRomesh Thapar (brother)Valmik Thapar (nephew)Pran Nath Thapar (uncle)Karan Thapar (cousin)AwardsHonorary doctorates University of Chicago, University of Oxford, Institut...

Vault housing the British Crown Jewels in the Tower of London 51°30′29″N 0°4′34″W / 51.50806°N 0.07611°W / 51.50806; -0.07611 Entrance to the Jewel House The Jewel House is a vault housing the British Crown Jewels in the Waterloo Block (formerly a barracks) at the Tower of London. It was opened by Queen Elizabeth II in 1994 and refurbished in 2012. Regalia have been kept in various parts of the Tower since the 14th century after a series of succes...

Human settlement in ScotlandStaffinScottish Gaelic: StafainStaffinLocation within the Isle of SkyeOS grid referenceNG483684Council areaHighlandCountryScotlandSovereign stateUnited KingdomPost townPortreePostcode districtIV51 9PoliceScotlandFireScottishAmbulanceScottish List of places UK Scotland 57°37′35″N 6°12′24″W / 57.62635°N 6.20670°W / 57.62635; -6.20670 Staffin at dusk viewed from the Quiraing ridge Dinosaur footprint on beach...

КоммунаКраншабанCramchaban 46°13′00″ с. ш. 0°43′00″ з. д.HGЯO Страна  Франция Регион Пуату — Шаранта Департамент Шаранта Приморская Кантон Курсон История и география Площадь 16,06 км²[1] Часовой пояс UTC+1:00, летом UTC+2:00 Население Население 611 человек (2010) Цифровые �...