Ncuti Gatwa
|
Read other articles:
Найба47°26′37″ пн. ш. 142°45′22″ сх. д. / 47.44384900002777528° пн. ш. 142.75617200002776030° сх. д. / 47.44384900002777528; 142.75617200002776030Витік Гирло Затока Терпіння (Охотське море)• координати 47°26′37″ пн. ш. 142°45′22″ сх. д. / 47.44384900002777528° пн. ш. 142.75617200002776030�...
Kosovo Kapitän Jeton Hadergjonaj Aktuelles ITF-Ranking 129 Statistik Erste Teilnahme 2016 Davis-Cup-Teilnahmen 6 Bestes Ergebnis Europa Gruppenzone III(2016–2018) Ewige Bilanz 1:20 Erfolgreichste Spieler Meiste Siege gesamt Granit Bajraliju (4) Meiste Einzelsiege Granit Bajraliju (3) Meiste Doppelsiege Granit Bajraliju, Genc Selita (je 1) Bestes Doppel Granit Bajraliju, Genc Selita (je 1) Meiste Teilnahmen Granit Bajraliju (19) Meiste Jahre Granit Bajraliju (6) Letzte Aktualisierung der In...
C. V. Raman Chandrasekhara Venkata Raman (चन्द्रशेखर वेङ्कट रामन्) (7 November 1888-21 November 1970) merupakan fisikawan India. Ia dilahirkan di Tiruchirapalli, Tamil Nadu. Dalam usia awal Raman pindah ke kota Visakhapatnam, Andhra Pradesh. Ia menamatkan BA and MA dalam Fisika dan Bahasa Inggrisnya dari Perguruan Tinggi Kepresidenan, Madras (kini Chennai). Ia menjadi anggota Pamong Praja India sebagai Asisten Jenderal Akuntan di Calcutta (kini Kolkat...
هذه المقالة تحتاج للمزيد من الوصلات للمقالات الأخرى للمساعدة في ترابط مقالات الموسوعة. فضلًا ساعد في تحسين هذه المقالة بإضافة وصلات إلى المقالات المتعلقة بها الموجودة في النص الحالي. (سبتمبر 2021) هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة...
1990 studio album by No Use for a NameIncognitoStudio album by No Use for a NameReleasedNovember 16, 1990RecordedSeptember 3–8, 1990StudioWestbeach Recorders, Hollywood, CaliforniaGenreHardcore punk[1]Length33:47LabelNew Red ArchivesProducerBrett GurewitzNo Use for a Name chronology Let 'Em Out!(1990) Incognito(1990) Don't Miss the Train(1992) Professional ratingsReview scoresSourceRatingAllMusic[1] Incognito is the debut album by No Use for a Name.[2] It was...
My Life in RuinsBerkas:MyLifeInRuinsPoster.jpgTheatrical release posterSutradara Donald Petrie Produser Michelle Chydzik Nathalie Marciano Ditulis oleh Mike Reiss PemeranNia VardalosRichard DreyfussAlexis GeorgoulisHarland WilliamsPenata musikDavid NewmanDavid MullenSinematograferJosé Luis AlcainePenyuntingPatrick J. Don VitoPerusahaanproduksi26 Films PlaytoneDistributorSearchlight Pictures Echo Bridge EntertainmentHollywood EntertainmentTanggal rilis 7 Mei 2009 (2009-05-07) (...
Peta Vizcaya menunjukkan lokasi Elorrio Elorrio merupakan nama kota di Spanyol. Letaknya di bagian utara. Tepatnya di Wilayah Otonomi Pais Vasco, Provinsi Vizcaya, Spanyol. Pada tahun 2005, kota ini memiliki jumlah penduduk sebanyak 7.094 jiwa (2005) dan memiliki luas wilayah 37,40 km². Kota ini terletak 39 km dari Bilbao. Artikel bertopik geografi atau tempat Spanyol ini adalah sebuah rintisan. Anda dapat membantu Wikipedia dengan mengembangkannya.lbs
Family of transcription factors E2F is a group of genes that encodes a family of transcription factors (TF) in higher eukaryotes. Three of them are activators: E2F1, 2 and E2F3a. Six others act as suppressors: E2F3b, E2F4-8. All of them are involved in the cell cycle regulation and synthesis of DNA in mammalian cells. E2Fs as TFs bind to the TTTCCCGC (or slight variations of this sequence) consensus binding site in the target promoter sequence. E2F family Schematic diagram of the amino acid s...
Nitronatrit Kleine, weiße Nitronatrit-Kristalle, bedeckt mit hellbraunem Ton (Größe: 8,1 cm × 6,1 cm) Allgemeines und Klassifikation IMA-Nummer 1980 s.p.[1] IMA-Symbol Ntt[2] Andere Namen Chilesalpeter Natriumnitrat Natronsalpeter Nitratin Chemische Formel Na[NO3][3] Mineralklasse(und ggf. Abteilung) Carbonate und Nitrate (ehemals Carbonate, Nitrate und Borate) System-Nummer nach Strunz (8. Aufl.) Lapis-Systematik(nach Strunz und Weiß) Str...
StabatKecamatanKantor Kecamatan StabatStabatPeta lokasi Kecamatan StabatTampilkan peta IndonesiaStabatStabat (Indonesia)Tampilkan peta IndonesiaKoordinat: 3°44′37″N 98°26′46″E / 3.743670°N 98.446220°E / 3.743670; 98.446220Negara IndonesiaProvinsiSumatera UtaraKabupatenLangkatPemerintahan • CamatNuriadi, S.Sos[1]Populasi (2021)[2] • Total93.063 jiwa • Kepadatan857/km2 (2,220/sq mi)Kode pos208...
Charakteristische Landschaft in den Dombes mit Fischteichen Dombes (im Französischen sowohl Les Dombes als auch La Dombes, Arpitan: La Domba) ist eine Landschaft in Ostfrankreich, im Frühmittelalter Teil der Provinz Burgund, heute Teil des Départements Ain in der Region Auvergne-Rhône-Alpes. Inhaltsverzeichnis 1 Geographie 2 Geschichte 3 Gemeinden in den Dombes 4 Siehe auch 5 Weblinks Geographie Die Dombes werden im Westen von der Saône, im Süden von der Rhône, im Osten vom Ain und im ...
مبنى الإذاعة والتلفزيون المصريالتسميةنسبة الاسم إلى جاستون ماسبيرو معلومات عامةنوع المبنى مبنى المنطقة الإدارية محافظة القاهرة البلد مصر معلومات أخرىالإحداثيات 30°03′12″N 31°13′51″E / 30.0533°N 31.2308°E / 30.0533; 31.2308 تعديل - تعديل مصدري - تعديل ويكي بيانات 30°03′12″N 31°13...
2016–17 concert tour by Green Day Revolution Radio TourTour by Green DayPromotional poster for the tourAssociated albumRevolution RadioStart dateSeptember 26, 2016 (2016-09-26)End dateNovember 19, 2017 (2017-11-19)Legs8No. of shows120Green Day concert chronology 99 Revolutions Tour(2013) Revolution Radio Tour(2016–17) Hella Mega Tour(2021–22) The Revolution Radio Tour was a concert tour by American rock band Green Day in support of the group's twelfth studi...
Not to be confused with Maryino District. District in federal city of Moscow, RussiaMaryina Roshcha District район Марьина рощаDistrictStreet in Maryina Roshcha District FlagCoat of armsLocation of Maryina Roshcha District in Moscow (pre-2012 map)Coordinates: 55°48′N 37°37′E / 55.800°N 37.617°E / 55.800; 37.617CountryRussiaFederal subjectfederal city of Moscow[1]Population (2010 Census)[2] • Total65,973 •&...
Peace treaty which ended the First Punic War Treaty of LutatiusTypePeace TreatyContextTreaty to end the First Punic War between Carthage and RomeDrafted241 BCSigned241 BCWith a codicil added in 237 BCMediators Hamilcar Barca Gaius Lutatius Catulus Negotiators Gisco Gaius Lutatius Catulus Quintus Lutatius Cerco Parties Carthage Rome vteFirst Punic War Treaties Messana Agrigentum 1st Mytistratus Lipari Islands Mylae Thermae 2nd Mytistratus Sulci Tyndaris Cape Ecnomus Aspis Adys Bagradas (Tunis)...
Indian dynasty (c. 225 – c.340) For other uses, see Ikshvaku (disambiguation). Ikshvakus of VijayapuriEarly 3rd century–early 4th centurySouth Asia350 CEYAUDHEYASARJUNAYANASMADRAKASMALAVASIKSHVAKUSKALABHRASWESTERNGANGASTOCHARIANSKADAMBASPALLAVASLITTLEKUSHANSLICCHAVISWESTERNSATRAPSSASANIANHINDMAHAMEGHA-VAHANASKAMARUPAGAUDASAMATATASDAVAKAKIDARITESABHIRASVAKATAKASGUPTAEMPIREKUSHANO-SASANIANSSAKASTANTURANMAKRANSASANIANEMPIRE ◁ ▷ Location of the Andhra Ikshvakus in c. 350 CECapitalVi...
Indian historian (born 1931) Romila ThaparThapar in 2016Born (1931-11-30) 30 November 1931 (age 92)Lucknow, United Provinces, British IndiaAlma materPanjab University SOAS University of London (PhD) Occupation(s)Historian, WriterKnown forAuthoring books about Indian historyParentDaya Ram Thapar (father)RelativesRomesh Thapar (brother)Valmik Thapar (nephew)Pran Nath Thapar (uncle)Karan Thapar (cousin)AwardsHonorary doctorates University of Chicago, University of Oxford, Institut...
Vault housing the British Crown Jewels in the Tower of London 51°30′29″N 0°4′34″W / 51.50806°N 0.07611°W / 51.50806; -0.07611 Entrance to the Jewel House The Jewel House is a vault housing the British Crown Jewels in the Waterloo Block (formerly a barracks) at the Tower of London. It was opened by Queen Elizabeth II in 1994 and refurbished in 2012. Regalia have been kept in various parts of the Tower since the 14th century after a series of succes...
Human settlement in ScotlandStaffinScottish Gaelic: StafainStaffinLocation within the Isle of SkyeOS grid referenceNG483684Council areaHighlandCountryScotlandSovereign stateUnited KingdomPost townPortreePostcode districtIV51 9PoliceScotlandFireScottishAmbulanceScottish List of places UK Scotland 57°37′35″N 6°12′24″W / 57.62635°N 6.20670°W / 57.62635; -6.20670 Staffin at dusk viewed from the Quiraing ridge Dinosaur footprint on beach...
КоммунаКраншабанCramchaban 46°13′00″ с. ш. 0°43′00″ з. д.HGЯO Страна Франция Регион Пуату — Шаранта Департамент Шаранта Приморская Кантон Курсон История и география Площадь 16,06 км²[1] Часовой пояс UTC+1:00, летом UTC+2:00 Население Население 611 человек (2010) Цифровые �...