Paracladopelma camptolabis
|
Read other articles:
This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Brazilian schools in Japan – news · newspapers · books · scholar · JSTOR (October 2015) (Learn how and when to remove this template message) Instituto Educacional Centro Nippo Brasileiro (Nippaku Gakuen) in Oizumi, Gunma Brazilian schools in Japan (ブラジル...
Region di Tanzania Region adalah wilayah administratif tingkat satu di Tanzania. No. Region Ibu kota Kode Jumlahdistrik Luas(km²) Populasi(sensus 2012) 1 Arusha Arusha TZ-01 7 37,576 1,694,310 2 Dar es Salaam Dar es Salaam TZ-02 5 1,393 4,364,541 3 Dodoma Dodoma TZ-03 7 41,311 2,083,588 4 Geita Geita TZ-27 5 20,054 1,739,530 5 Iringa Iringa TZ-04 5 35,503 941,238 6 Kagera Bukoba TZ-05 8 25,265 2,458,023 7 Katavi Mpanda TZ-28 3 45,843 564,604 8 Kigoma Kigoma TZ-08 8 37,040 2,127,930 9 Kiliman...
اضغط هنا للاطلاع على كيفية قراءة التصنيف دجاجة الماء منقطة الأجنحة حالة الحفظ أنواع غير مهددة أو خطر انقراض ضعيف جدا[1] المرتبة التصنيفية نوع[2][3] التصنيف العلمي النطاق: حقيقيات النوى المملكة: حيوانات الفرقة العليا: البعديات الحقيقية القسم: ثانويات الفم الشعب
Form of ultralight aviation ParamotoringParamotorHighest governing bodyFédération Aéronautique InternationaleCharacteristicsContactNoMixed-sexYesTypeAir sportsPresenceCountry or regionWorldwideOlympicNoWorld Games2017 Two powered paragliders in flight Powered paraglider at a Kanagawa beach in Japan, 2022 Powered paragliding, also known as paramotoring or PPG, is a form of ultralight aviation where the pilot wears a back-pack motor (a paramotor) which provides enough thrust to tak...
53°31′33″N 1°37′41″W / 53.5258°N 1.6280°W / 53.5258; -1.6280 The cinema in Penistone The Penistone Paramount Cinema is a community cinema and theatre in Penistone, near Barnsley, in the heart of the South Yorkshire Pennines. Besides the big film releases, there are live shows and monthly organ concerts. The cinema is also home to one of the few working theatre organs in the country. The Paramount Compton Organ has been recently rebuilt, and was the reason w...
Component city in the Philippines Component city in Western Visayas, PhilippinesSan CarlosComponent cityCity of San CarlosPort of San Carlos FlagSealMotto(s): ¡Vamos, San Carlos!Anthem: Dakbayan, San Carlos, Mahal KoMap of Negros Occidental with San Carlos highlightedOpenStreetMapSan CarlosLocation within the PhilippinesCoordinates: 10°29′35″N 123°24′34″E / 10.492936°N 123.409456°E / 10.492936; 123.409456CountryPhilippinesRegionWestern VisayasProvince...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
2013 studio album by Marnie SternThe Chronicles of MarniaStudio album by Marnie SternReleasedMarch 19, 2013StudioRare Book Room, Brooklyn, New YorkGenreExperimental rock, indie rockLength32:46LabelKill Rock StarsProducerNicolas VernhesMarnie Stern chronology Marnie Stern(2010) The Chronicles of Marnia(2013) The Comeback Kid(2023) Singles from The Chronicles of Marnia Year of the GladReleased: December 11, 2012[1] Nothing Is EasyReleased: February 14, 2013[2] Profession...
British barrister and activist (1882–1957) Helena NormantonBornHelena Florence Normanton(1882-12-14)14 December 1882East London, EnglandDied14 October 1957(1957-10-14) (aged 74)Sydenham, London, EnglandEducationUniversity of LondonKnown forOne of the first female barristers, campaigner for women's rights, pioneer of divorce reform, and the first married woman to hold a British passport in her own name, after she declined to take on her husband's surname. Helena Florence Normanton,...
Biathlon World Championships 1958Host citySaalfeldenCountryAustriaEvents2Opening1 March 1958 (1958-03-01)Closing2 March 1958 (1958-03-02)Courmayeur 1959 → The 1st Biathlon World Championships were held in 1958 in Saalfelden, Austria.[1] The men's 20 km individual and team were the only competitions. Men's results 20 km individual Medal Name Nation Penalties Result Behind Adolf Wiklund SWE 3 1:33:44 Olle Gunneriusson SWE 3 1:34:...
Fundo Nacional Para as HumanidadesHistóriaFundação 29 de setembro de 1965Quadro profissionalSigla (en) NEHTipo agência independente do governo dos Estados UnidosEstado legal fundaçãoPaís Estados UnidosOrganizaçãoAfiliação National Digital Stewardship Alliance (d) ( de 2022)Website (en) www.neh.goveditar - editar código-fonte - editar Wikidata O Fundo Nacional Para as Humanidades (National Endowment for the Humanities ou NEH em inglês) é uma agência federal ...
Questa voce sull'argomento calciatori ungheresi è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. Ádám Lang Nazionalità Ungheria Altezza 185 cm Peso 77 kg Calcio Ruolo Difensore Squadra Omonia Carriera Giovanili 2004-2008 Veszprém Squadre di club1 2008-2012 Veszprém44 (3)2012-2015 Győri ETO57 (1)2015-2016 Videoton23 (2)2016-2018 Digione22 (0)2017 Digione 21 ...
Lawyer and 693rd Lord Mayor of London AldermanVincent KeavenyCBE KStJKeaveny in 2022693rd Lord Mayor of LondonIn office13 November 2021 – 11 November 2022Preceded bySir William RussellSucceeded byNicholas Lyons Personal detailsBornVincent Thomas Keaveny (1965-07-01) 1 July 1965 (age 58)Dublin, Leinster, IrelandEducationSt Michael's College, DublinAlma materUniversity College, DublinTrinity College, DublinOccupationLawyerAwards Knight of St John Vincent Thomas Keaveny C...
Single-hull Suezmax oil tanker History NameSea Empress OwnerOriental Ocean Shipping Builder Spain Launched6 June 1992 Acquired2010 Out of service2012 Identification IMO number: 8906999 Callsign: 3ETO5 FateScrapped 2012 General characteristics Tonnage147,273 DWT Length274.3 m (899.93 ft) Beam43.2 m (141.73 ft) Draft17.02 m (55.84 ft) Installed power13,475 kW (18,070.27 hp) Propulsiondirect-drive diesel, single propeller Capacity164,156 m3 ...
2003 soundtrack album by Various ArtistsHouse of 1000 CorpsesSoundtrack album by Various ArtistsReleasedMarch 25, 2003GenreSoundtrack, heavy metal, country[1]Length45:09LabelGeffenProducerScott HumphreyRob Zombie Professional ratingsReview scoresSourceRatingAllmusic[2] House of 1000 Corpses is the soundtrack album for the movie House of 1000 Corpses, directed by Rob Zombie. It includes artists such as Buck Owens, Helen Kane, The Ramones, Lionel Richie, Slim Whitman, Tr...
In this Chinese name, the family name is Fung. Fung Hoi Man Personal informationFull name Fung Hoi ManDate of birth (1977-03-12) 12 March 1977 (age 46)Place of birth Hong KongHeight 1.66 m (5 ft 5+1⁄2 in)Position(s) MidfielderYouth career1991–1993 Eastern1993–1994 Sing TaoSenior career*Years Team Apps (Gls)1994–1997 Sing Tao 2006–2007 HKFC 4 (0)Managerial career2000–2002 Diocesan Boys' School2002–2003 Sham Shui Po2003–2004 Hong Kong 08 (assistant coach)...
2000 studio album by New Found GloryNew Found GloryStudio album by New Found GloryReleasedSeptember 26, 2000 (2000-09-26)RecordedJune 2000StudioElysian Fields, Boca Raton, FloridaGenrePop punkLength36:20LabelDrive-Thru, MCAProducerNeal AvronNew Found Glory chronology From the Screen to Your Stereo(2000) New Found Glory(2000) Sticks and Stones(2002) Singles from New Found Glory Hit or MissReleased: June 17, 2000[citation needed] Dressed to KillReleased: November ...
Public high school in Colby, Wisconsin, United StatesColby High SchoolColby High School, Oct 2012Address705 N 2nd StreetColby, WisconsinUnited StatesCoordinates44°55′13″N 90°19′07″W / 44.920141°N 90.318711°W / 44.920141; -90.318711InformationTypePublic High SchoolSchool districtColby School DistrictNCES District ID5502730SuperintendentPatrick GalliganNCES School ID550273000309PrincipalMarcia DiedrichTeaching staff18.41 (FTE)[1]Grades9–12GenderCoed...
HS Tirol in the First World War. History Name SS Tirol (1901–1916) HS Tirol (1916–1918) Trento (1921–1929) NamesakeTirol, Trento OwnerLloyd Austriaco, Lloyd Triestino Port of registry/ Trieste, Italy/Austria-Hungary Launched28 September 1901 Completed5 January 1902 In service1901 FateScrapped, 1929 General characteristics TypeHospital ship Tonnage2,836 GRT SS Tirol was an Austro-Hungarian hospital ship that was mined in the Adriatic Sea off Durazzo on 16 April 1916 but was salvaged...
Inclán - Mezquita Al Ahmad UbicaciónCoordenadas 34°37′46″S 58°24′03″O / -34.62936111, -58.40097222Dirección Av. Jujuy 1700Barrio Parque PatriciosComuna 4Ciudad Ciudad de Buenos AiresDatos de la estaciónPunto kilométrico 5,6 kmAccesibilidad Inauguración 31 de mayo de 2007 (16 años) (obras) 18 de octubre de 2007 (16 años) (definitiva)Servicios Conexiones JujuyN.º de andenes 2 (lateral)N.º de vías 2Tipología SubterráneaPropietario Subterrán...