The Star Control copyrights were separated from the trademark in the early 2000s. Accolade allowed their copyright license to expire and revert to Reiche and Ford, who re-released Star Control II as The Ur-Quan Masters. Meanwhile, Accolade's assets were acquired by Atari SA, who later declared bankruptcy in 2013. Stardock purchased Atari's Star Control assets in a bankruptcy auction, leading the parties to acknowledge that Reiche and Ford retained their copyrights, while Stardock owned the trademark. In 2017, each side accused the other of violating their rights: Stardock was selling the original games without Reiche and Ford's consent, whereas Reiche and Ford announced a sequel to Star Control II without Stardock's consent. Stardock filed a lawsuit, and Reiche and Ford counterclaimed that Stardock was unlawfully selling their games and misappropriating their work in the upcoming game Star Control: Origins. Stardock responded by filing trademarks in character names from the original Star Control games.
In late 2018, Stardock's request for an injunction against a copyright takedown was denied by Judge Saundra Brown Armstrong. Steam and GOG.com removed the games from their stores, but restored Origins after Stardock agreed to accept responsibility for any potential infringement. In 2019, both sides agreed to a settlement, with Reiche and Ford owning the copyright to Star Control I and II, and Stardock owning the Star Control trademark. Both series would remain separate, with Reiche and Ford avoiding use of the original name, and Stardock avoiding use of the original fictional universe.
Intellectual property history
Original Star Control series
Star Control and Star Control II were created by Paul Reiche III and Fred Ford and published by Accolade.[1] Released in 1990 and 1992 respectively, both games received numerous awards.[2] Journalists have listed Star Control among their best games of all time,[3] with Star Control II earning even more "best game" rankings through the 1990s,[4] 2000s,[5] and 2010s.[6] It is also ranked among the best games in several creative areas, including writing,[7] world design,[8] character design,[9] and music.[10]
Star Control was Ford and Reiche's first collaboration.[11][12] The sequel was more ambitious, forcing the duo to ask their creative friends for help,[13] and forcing Ford to financially support the team when the production went over schedule.[14]Accolade asked Ford and Reiche to make a third game at the same budget, which they turned down to pursue other projects.[15] As Reiche and Ford held the copyrights over first two Star Control games,[14] Accolade licensed Reiche and Ford's designs to make Star Control 3 with a different team.[16][14] Released in 1996, Star Control 3 did not enjoy the acclaimed legacy of the first two games, with reviewers noting the change in authorship.[17][11][18] Accolade's plans for a fourth Star Control game were ultimately cancelled during development,[19][20] and fans continued to demand a new Star Control game well into the late 2000s.[21][22]
Separation of rights
By the early 2000s, the Accolade's publishing agreement with Reiche and Ford expired.[23] This was triggered by a contractual clause when the games were no longer generating royalties, allowing the copyrighted content to revert to Reiche and Ford.[24][25] As the games were no longer available in stores, Reiche and Ford wanted to keep their work in the public eye, to maintain an audience for a potential sequel.[24] Reiche and Ford still owned the copyrights in Star Control I and II, but they could not successfully purchase the Star Controltrademark, leading them to consider a new title for a potential follow-up.[26][14] This led them to remake Star Control II as The Ur-Quan Masters,[27] which they released in 2002 as a free download under an open source copyright license.[28] The official free release prevented the game from becoming abandonware.[29]
Meanwhile, the Star Control trademark was transferred to Infogrames Entertainment.[27] This happened when Star Control publisher Accolade sold their company to Infogrames in 1999,[30] who merged with Atari and re-branded under the Atari name in 2003.[31][32] In 2011, GOG.com began selling a Star Control re-release on their digital store.[33] Ford contacted the sales platform, saying they could not sell the games without permission, leading GOG.com to separately license the Star Control trademark from Atari, and the games themselves from Reiche and Ford.[16][1][34]
Atari declared bankruptcy in 2013, and their assets were listed for auction.[35] Stardock became the top bidder on Atari's Star Controlintellectual property.[36] Upon hearing the news, Paul Reiche indicated that he still owned the copyright in the original Star Control games, so Stardock must have purchased the Star Control trademark, and this was confirmed by Stardock.[37][38] Indeed, the Atari asset purchase agreement listed two assets sold to Stardock: the Star Control trademark and the Star Control III copyright.[1] As Stardock began developing their new Star Control game, they re-iterated that they did not acquire the copyright to the first two games, and that they would need a license from Reiche and Ford to use their content and lore.[31][39] Reiche and Ford echoed this understanding in a 2015 Game Developer Conference interview, stating that Stardock's game would use the Star Control trademark only.[40]
Legal dispute
Facts
In September 2015, Stardock announced that their new game Star Control: Origins would be a prequel to Star Control.[42] Through email, Stardock asked Reiche and Ford for a license to use their character designs, but the duo repeatedly declined.[16][23] By 2016, Stardock described Origins as an alternative timeline in the same Star Controlmultiverse, but with none of the older games' characters,[26] to avoid infringing on Reiche and Ford's copyrighted lore.[31][39] Despite Stardock's continued offers, Reiche and Ford declined to collaborate on Origins, citing a desire to create their own sequel once they finished their ongoing projects with Activision.[26][1]
In October 2017, Stardock began selling the older Star Control games via the Steam store, as a promotion for Origins.[43] Through email, the parties began to dispute what legal rights Stardock had purchased from Atari,[44] and whether that included distribution rights over the original series.[1][45] Despite private negotiations, Stardock declined to stop selling the games, leading Reiche and Ford to formally request that Steam remove the original series from their store via a Digital Millennium Copyright Act (DMCA) takedown notice. Stardock formally contested the notice, and the sales continued.[44][1] When Reiche and Ford publicly announced that they did not consent to Stardock's sale of the original series, Stardock announced that they had purchased the Star Control publishing rights from Atari, while Reiche and Ford responded that Atari's publishing rights had lapsed by Atari's own admission.[45]
Also in October, Reiche and Ford announced Ghosts of the Precursors as a direct sequel to Star Control II.[46] Initially, Stardock supported this announcement for Ghosts of the Precursors as a "true sequel to Star Control 2",[46][47] and claimed their new Origins game would take place in an alternate universe that split off from the original series' universe.[48] By December 1, Reiche and Ford announced that Stardock had not negotiated their legal permissions, and that "our games' universe has absolutely no connection, hyper-dimensional or otherwise".[49][50] Responding to allegations that Stardock threatened to stop Reiche and Ford from releasing Ghosts of the Precursors, Stardock announced their lawyers would handle the dispute.[51][23]
Trademark claim
On December 8, 2017, Stardock filed a lawsuit against Reiche and Ford in the U.S. District Court for the Northern District of California. Stardock's main contention was that their Star Control trademark was infringed when Reiche and Ford announced Ghosts of the Precursors as a "direct sequel" to Star Control II.[1] Stardock further contended that Reiche and Ford were not the creators of Star Control, and were misleading consumers about their involvement in the series.[1] In the months that followed, Stardock applied for more than 20 new trademarks, and filed an amended claim in March 2018 to claim ownership over them. These trademark applications included names of alien races from the original Star Control, and the mark The Ur-Quan Masters.[52] If authorized by the United States Patent and Trademark Office, Stardock's new trademarks could have the effect of preventing Reiche and Ford from using those aliens in a new game.[53] When correspondence surfaced that Stardock planned to use The Ur-Quan Masters and Star Control trademarks to shut down criticism from both games' fan forums, Stardock CEO Brad Wardell responded that this was a moment of anger and he had no intention of actually doing so.[54]
Defense and copyright counterclaim
In February 2018, Reiche and Ford answered Stardock's complaint by asserting several defenses, as well as raising a counterclaim against Stardock for copyright infringement.[55] Reiche and Ford argued that their Ghosts of the Precursors announcement did not infringe Stardock's trademark, and suggested that Atari's trademark renewal was invalid given that Star Control was not used in trade for several years.[16] Reiche and Ford also counterclaimed that Stardock was liable for copyright infringement due to Stardock's unauthorized use of characters and designs from Star Control I and II, and unauthorized sale of the original games.[1] Reiche and Ford further pointed out that Stardock had no valid copyright or distribution rights because, under their original contract, Accolade had lost those rights in 2001 when it ceased to sell the games in stores.[1] Reiche and Ford also represented that they never authorized Atari or Stardock to distribute their games, but that they did authorize GOG.com.[1] Reiche and Ford further contested Stardock's claim over TheUr-Quan Masters trademark, and alleged that Stardock had misled customers about the duo's involvement with Origins.[16]
Settlement discussions
In March 2018, Reiche and Ford described an alleged settlement offer made by Stardock, asking Reiche and Ford to compensate Stardock US$225,000 in damages, assign their Star Control intellectual property to Stardock, and refrain from making any game in the same genre as Stardock for five years. Reiche and Ford rejected this settlement as "unfathomable".[52] Stardock responded that the two has misrepresented the terms of the confidential settlement offer, leading Reiche and Ford to publish the settlement offer publicly.[56][57] A week later, the court ordered the parties to keep all settlement negotiations confidential.[58] As Reiche and Ford were sued personally, they turned to crowdfunding to pay for some of their legal costs.[59]
Ruling on Stardock's motion for preliminary injunction
On September 7, 2018, Stardock filed a motion with the Court requesting a preliminary injunction preventing Reiche and Ford from issuing a DMCA takedown notice against Stardock's forthcoming Origins game.[60][61] Judge Saundra Brown Armstrong denied Stardock's request on December 27, 2018, agreeing with Reiche and Ford that Stardock had been aware of the intellectual property issues by their own admission, but still started work on a potentially infringing product, calling the situation one of Stardock's own making.[61] Describing some of the claims as "frivolous", Judge Armstrong wrote:[62]
Defendants [(Reiche and Ford)] object to Wardell's declaration [that] "Stardock has not incorporated any copyrightable artwork from Star Control I, Star Control II or Star Control III into the Origins game itself," on the ground that Wardell lacks the expertise necessary to opine as to what constitutes "copyrightable artwork". Indeed, not only has Wardell failed to establish any such expertise, but his opinion as to whether the work in question is "copyrightable" constitutes an improper legal conclusion. Such legal conclusions are without evidentiary value.
...
Plaintiff [(Stardock)] had knowledge of Defendants' copyright claims from the outset. Despite that knowledge, it developed potentially infringing material without resolution of the IP ownership issues, and then publicized the release of that material during the pendency of this action. It now claims that its investment in Origins and reputation are on the line. Given that Plaintiff largely created the foregoing predicament, the Court is disinclined to extricate Plaintiff from a peril of its own making.
After the ruling, Reiche and Ford issued a DMCA takedown notice to Steam and GOG.com. Stardock did not file a counter-notice, and the games were subsequently removed from sale at the beginning of 2019.[62] Reiche and Ford defended the DMCA takedown requests by pointing out that the substantial similarities between Origins and Star Control II were evidence of intentional copying, in violation of copyright.[63] Later that month, both Steam and GOG.com restored Origins for sale. When Stardock owner Brad Wardell mentioned that the digital stores had reviewed and reconsidered the takedown, Polygon revealed correspondence where Stardock offered to accept potential copyright liability and secure both stores from the consequences of litigation.[64]
Settlement and intellectual property split
In June 2019, the parties agreed to a settlement,[65][66] with Reiche and Ford owning the right to continue their series, while Stardock owns the right to use the Star Control name for a separate game.[67][68] Reiche and Ford would use a new name for their fictional universe,[69] while Stardock promised to avoid using any plots, characters, or locations that would infringe on Reiche and Ford's copyrights.[66] Both sides agreed that Stardock will own the Star Control trademark, and Reiche and Ford will own the Ur-Quan Masters trademark, with a perpetual trademark license to the Ur-Quan Masters fan community for their open source project.[65] As part of this, Stardock dropped their trademark claims to the alien names from the first two games.[65] Reiche and Ford also agreed to remain quiet about Ghosts of the Precursors for a few years, and rename their eventual sequel.[66] Reiche and Ford later announced Free Stars: Children of Infinity as a sequel to The Ur-Quan Masters, which they re-released under the new "Free Stars" series name.[70][71][72]
^ abHutchison, Lee (July 7, 2020). Dacanay, Sean; Niehaus, Marcus (eds.). "Star Control Creators Paul Reiche & Fred Ford: Extended Interview"(Transcript). Ars Technica. Archived from the original on July 7, 2020. Retrieved July 7, 2020. Fred Ford: Star Control II, well and Star Control I have always been near and dear to our hearts. It's the first things we worked on, the first things we poured our passion in together. We have some diehard fans as a result of those two games and we wanted to service them and lay the groundwork for a return and keep the games in the fronts of their minds as much as possible so that when we were finally able to return to it we would still have a living audience. Paul Reiche: There was a confluence of events that helped this. One was Accolade stopped selling the game and we stopped earning royalties right around your 2000 and that triggered the termination of their exclusive right to sell our game. So we got our game back. What we didn't have was the name Star Control. That was a trademark that the publisher owned and we negotiated back and forth with them, but ultimately we weren't able to come to terms for the name. So we decided, well we can't use that name, let's give it a new name, so we used the Ur-Quan Masters ... So the "Ur-Quan Masters" project, the open-source release of the game we created as Star Control II, that really kept our game alive in the doldrums between say 2001 or 2002 and then 2011 when our games began to be sold again through Good Old Games, known as GOG, which is an electronic distributor of classic games.{{cite web}}: CS1 maint: bot: original URL status unknown (link)
^"Interview with Fred Ford". classicgaming.com. May 15, 2001. Archived from the original on May 15, 2001. Retrieved November 29, 2020. Fred Ford: [Accolade] owe us another payment for our portion of the property. They have told us they are going to default on this payment which means we are back to owning the characters and settings. They still own the trademark/name and continue to look for someone to buy it from them.
^Wen, Howard (August 11, 2005). "The Ur-Quan Masters". linuxdevcenter.com. O'Reilly Media. Archived from the original on March 16, 2016. When the original developers of Star Control 2 contacted the online Star Control fan community, they presented an enticing question: if they released the source to the 3DO version of Star Control 2 under GPL, would anybody be interested in porting it to modern-day computers? Michael Martin, a 26-year-old Ph.D. student at Stanford University, answered the call. After removing proprietary 3DO-specific components from the code, the developers released the source for Star Control 2 to the public.
^ abBradley Wardell (September 3, 2015). "Star Control: September 2015 update". Stardock. Archived from the original on August 26, 2016. Retrieved January 2, 2019. ... my position is that Stardock doesn't have the legal rights to the original lore either. Or, if we did, we have long since refuted those rights. The Star Control classic lore are the copyright of Paul Reiche and Fred Ford.
^Fred Ford & Paul Reiche III (June 30, 2015). "Classic Game Postmortem: Star Control". Game Developers Conference. Retrieved October 22, 2020 – via YouTube. Paul Reiche III: When Accolade / Atari / the various companies that acquired it went out of business, they had the trademark Star Control. All of the material, all the aliens, all of the story belongs to Fred and myself. So they're taking the Trademark and moving forward with that.
^Bradley Wardell (September 3, 2015). "Star Control: September 2015 update". Stardock. Archived from the original on January 3, 2019. Retrieved January 2, 2019. The new Star Control is a prequel. It takes place before the events of the original series.
^Austin Wood (October 10, 2017). "25 years later, Star Control 2 is getting a direct sequel". PC Gamer. Bradley Wardell: [Paul Reiche] asked us not to try to make a sequel to Star Control 2 and said that he hoped one day to be able to return to the universe he and Fred Ford created. Recently, Paul told me the good news: Activision was going to let him do a true sequel to Star Control 2.
^Wardell, Brad (September 23, 2018). "Regarding 'Star Control: Origins' and Stardock". forum.uqm.stack.nl. Archived from the original on August 15, 2020. Retrieved November 17, 2020. Bradley Wardell: ... members of the community insisted that we needed to send Serge and co a trademark license in order to send a message that Stardock would not interfere with the UQM project. Thus, this past Summer, I relented and asked the lawyers to draft up a very short licensing agreement for the trademarks in question and sent it over. Your first response was simply to state that you didn't think you needed to sign a licensing agreement which echoed my position and I've seen no reason to pursue it further. If I don't see a reason and you don't see a reason then when should we invest time and energy pursuing it further? With regards to my *private* venting regarding some of the extremely toxic and hate-filled posts that have been directed at me *personally* from this forum. It is true that on occasion I have vented that this forum (not the project but the forum) should be shut down. ... But I would like to think that most of you understand the difference between being angry versus acting on that anger. We have not, nor do we plan to, take any action against any Star Control fan community.
^Spero, Joseph C. (March 29, 2018). "Order Regarding Settlement Discussions"(PDF). United States District Court - Northern District of California. Retrieved December 13, 2020.
KuwaitJulukanAl AzraqAsosiasiAsosiasi Sepak Bola KuwaitKonfederasiAFC (Asia)Sub-konfederasiWAFF (Asia Barat)PelatihNabil MaâloulPenampilan terbanyakBader Al-Mutawa (149)Pencetak gol terbanyakBashar Abdullah (75)Stadion kandangJaber Al-Ahmad International StadiumKode FIFAKUWPeringkat FIFATerkini 137 1 (15 Februari 2024)[1]Tertinggi24 (Desember 1998)Terendah189 (Desember 2017)Peringkat EloTerkini 120 2 (19 Januari 2024)[2] Warna pertama Warna kedua Pertandingan internasional pe...
Lee Tae-vinLee Taevin pada tahun 2022LahirLee Se-woong22 Januari 1996 (umur 28)Busan, Korea SelatanKebangsaanKorea SelatanPekerjaanPemeranPenyanyiTahun aktif2017-sekarangAgenKeyEast (2021-sekarang), Crebig Entertainment (2019-2021), Music Works (2017-2019) Lee Se-woong (hangul: 이세웅) lebih dikenal dengan nama Lee Tae-vin (hangul: 이태빈) adalah pemeran dan penyanyi Korea Selatan.[1] Perjalanan Karier Debut Sebagai Anggota Grup Idola Lee Tae-vin debut sebagai anggota...
ستيف مارليت (بالفرنسية: Steve Marlet) معلومات شخصية الاسم الكامل ستيف مارليت الميلاد 10 يناير 1974 (العمر 50 سنة)[1]كايين الطول 1.80 م (5 قدم 11 بوصة) مركز اللعب المهاجم الجنسية فرنسا المسيرة الاحترافية1 سنوات فريق مشاركات (أهداف) 1991–1996 النجم الأحمر 137 (42) 1996–2000 أوك�...
Pour les articles homonymes, voir Verne. Michel VerneMichel Verne en 1891.BiographieNaissance 4 août 186110e arrondissement de ParisDécès 5 mars 1925 (à 63 ans)ToulonSépulture Cimetière Saint-Pierre de MarseilleNom de naissance Michel Jean Pierre VerneNationalité françaiseFormation Colonie agricole et pénitentiaire de Mettray (1876)Activités Écrivain, auteur de littérature pour la jeunesse, producteur, réalisateur, romancier, producteur de cinéma, écrivain de science-fict...
Signal representation The Fourier transform converts the function's time-domain representation, shown in red, to the function's frequency-domain representation, shown in blue. The component frequencies, spread across the frequency spectrum, are represented as peaks in the frequency domain. In mathematics, physics, electronics, control systems engineering, and statistics, the frequency domain refers to the analysis of mathematical functions or signals with respect to frequency (and possibly ph...
Sakramen Imamat adalah sakramen yang dengannya seseorang dijadikan uskup, imam, atau diakon, sehingga penerima sakramen ini dibaktikan sebagai citra Kristus (In persona Christi). Hanya uskup (termasuk juga patriark dan paus) yang berhak dan boleh melayankan sakramen ini. Orang-orang yang berkeinginan menjadi imam dituntut oleh Hukum Kanonik (Kanon 1032 dalam Kitab Hukum Kanonik) untuk menjalani suatu program seminari yang selain berisi studi filsafat dan teologi sampai lulus, juga mencakup su...
Late 8th-century–1215 Iranian dynasty from Ghor, modern Afghanistan Ghurid dynasty786–12151203KHWARAZMIANEMPIREKIPCHAKSABBASIDCALIPHATEZENGIDSYADAVASPARA-MARASCHANDELASQOCHOQARA KHITAIKARA-KHANIDS ◁ ▷ Map of Ghurid territory, before the assassination of Muhammad of Ghor.[1][2][3] In the west, Ghurid territory extended to Nishapur and Merv,[4][5] while Ghurid troops reached as far as Gorgan on the shores of the Caspian Sea.[6][7] ...
80th season of La Liga Football league seasonLa LigaSeason2010–11Dates28 August 2010 – 21 May 2011ChampionsBarcelona21st titleRelegatedDeportivo de La CoruñaHérculesAlmeríaChampions LeagueBarcelonaReal MadridValenciaVillarrealEuropa LeagueSevillaAthletic BilbaoAtlético MadridMatches played380Goals scored1,042 (2.74 per match)Top goalscorerCristiano Ronaldo(40 goals)Biggest home winReal Madrid 7–0 Málaga(3 March 2011)[1] Real Madrid 8–1 A...
الرابطة البرلمانية 1964–65 تفاصيل الموسم دوري إسثميان البلد المملكة المتحدة الرابطة البرلمانية 1963–64 الرابطة البرلمانية 1965–66 تعديل مصدري - تعديل الرابطة البرلمانية 1964–65 (بالإنجليزية: 1964–65 Isthmian League) هو موسم من دوري إسثميان. فاز فيه Hendon F.C. [الإنجليزية]...
Irkutsk kotakota besar Иркутск (ru) flag of Irkutsk Tempat Negara berdaulatRusiaOblast di RusiaOblast IrkutskUrban okrug in RussiaIrkutsk Urban Okrug Ibu kota dariIrkutsky District Irkutsk Urban Okrug NegaraRusia Pembagian administratifQ4376063 Oktyabrsky Okrug Sverdlovsky Okrug Leninsky Okrug PendudukTotal579.268 (2009 )GeografiLuas wilayah277 km² [convert: unit tak dikenal]Dekat dengan perairanSungai Angara, Irkut, Ushakovka dan Irkutsk Reservoir Ketinggian440 m Berbatasa...
American politician (1902–2003) Senator Thurmond redirects here. For the South Carolina state senate member (his son), see Paul Thurmond. Strom ThurmondOfficial portrait, 1961United States Senatorfrom South CarolinaIn officeNovember 7, 1956 – January 3, 2003Preceded byThomas A. WoffordSucceeded byLindsey GrahamIn officeDecember 24, 1954 – April 4, 1956Preceded byCharles E. DanielSucceeded byThomas A. WoffordPresident pro tempore of the United States SenateIn officeJanu...
Division of the US National Aeronautics and Space Administration (NASA) which trains astronauts NASA space suits previously worn by the Astronaut Corps at the Johnson Space Center (center, Pete Conrad's suit worn during the 1969 Apollo 12 mission) Part of a series on theUnited States space program NASAU.S. Space Force Human spaceflight programs Mercury Gemini Apollo Skylab Space Shuttle Shuttle–Mir International Space Station Commercial Crew Constellation Artemis Lunar Gateway Robotic space...
← червень → Пн Вт Ср Чт Пт Сб Нд 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 2024 рік 6 червня — 157-й день року (158-й в високосного року) в григоріанському календарі. До кінця року залишається 208 днів. Цей день в історії: 5 червня—6 червня—7 червня Зміс�...
American failed assassin (born 1930) Sara Jane MooreBornSara Jane Kahn (1930-02-15) February 15, 1930 (age 94)Charleston, West Virginia, U.S.OccupationAccountantCriminal statusParoledConviction(s)Attempted assassination of the President of the United States (18 U.S.C. § 1751)Criminal penaltyLife imprisonment Sara Jane Moore (née Kahn; born February 15, 1930) is an American criminal who attempted to assassinate U.S. President Gerald Ford in 1975.[1][2] She was given a li...
Football tournament season 2023–24 FA CupFootball Association Challenge CupWembley Stadium hosted the final on 25 May 2024Tournament detailsCountryEnglandWalesDates3 November 2023 – 25 May 2024Teams732[1] (all)640 (qualifying competition)124 (main competition incl. 32 qualifiers)Defending championsManchester CityFinal positionsChampionsManchester United (13th title)Runner-upManchester CityTournament statisticsMatches played148Goals scored512 (3.46 per match)Attendan...
У этого термина существуют и другие значения, см. Дождь (значения). Запрос «Грибной дождь» перенаправляется сюда; также см. Грибной дождь (фильм). Дождь в Мексике До́ждь — атмосферные осадки, выпадающие из облаков в виде капель жидкости со средним диаметром от 0,5 до 6—7...
Venantino VenantiniVenantini pada 1966Lahir(1930-04-17)17 April 1930Fabriano, ItaliaMeninggal9 Oktober 2018(2018-10-09) (umur 88)Viterbo, ItaliaPekerjaanAktorTahun aktif1954–2018 Venantino Venantini (17 April 1930 – 9 Oktober 2018) adalah seorang pemeran film Italia.[1] Ia adalah ayah dari Victoria Venantini dan Luca Venantini [it] dan tampil dalam lebih dari 140 film antara 1954 dan 2018. Referensi ^ È morto l'attore Venantino Venantini (dal...
This article is about a city in Himachal Pradesh. For other uses, see Rampur (disambiguation). Town in Himachal Pradesh, IndiaRampur BushahrTownMain Bazaar of RampurRampur BushahrLocation in Himachal Pradesh, IndiaShow map of Himachal PradeshRampur BushahrRampur Bushahr (India)Show map of IndiaCoordinates: 31°27′0″N 77°37′59″E / 31.45000°N 77.63306°E / 31.45000; 77.63306Country IndiaStateHimachal PradeshDistrictShimlaGovernment • SDMNishant...