Carwow

Carwow
Type of businessPrivate/Group
Available inEnglish
Founded2011 (2011)
HeadquartersLondon, United Kingdom
Area servedWorldwide
OwnerBalderton Capital, Episode 1 Ventures
Founder(s)James Hind, Alexandra Margolis, David Santoro
Key peopleJohn Veichmanis (CEO)
IndustryAutomotive
URLhttps://www.carwow.co.uk/
Current statusActive
carwow
YouTube information
Channel
Presented byMat Watson
Years active2016-present
GenreCar Reviews
Subscribers9.77 million[1]
(December 2024)
Total views4.33 billion[1]
(December 2024)

Carwow is an online marketplace for buying and selling cars. It uses the reverse marketplace model to remove the need for customers to negotiate with dealers when buying or selling their cars. When buying a new car, users choose the car they want, along with the various specifications and features, and then receive offers directly from dealers.[2] When selling a car, users upload some basic details about their car (such as the registration number, mileage, and some photos), after which different car dealers are invited to bid to buy the car directly from them.[3] It also provides information to prospective purchasers and gives feedback on rogue dealers. The company has a YouTube page, run by motor journalist and Carwow's Chief Content Officer Mat Watson, where different cars are reviewed.[4] [5]

The company has partnered with the RAC as part of RAC Cars' ‘search, buy, sell’ website.[6]

Carwow was co-founded by James Hind, Alexandra Margolis, and David Santoro and launched in May 2013.[7][8] While operating Carbuzz, James Hind came across the concept from a company that used the reverse tendering concept called My Best Deal. My Best Deal was the concept of David Paterson, formerly in the motor industry. David Paterson operated at a management level within the motor industry, providing finance and insurance services to clients. Carwow’s investors include Balderton Capital, Episode 1 Ventures, Samos Investments, and Accel Partners.[9] The company had sold over 20,000 cars valued at £550 million by January 2016.[10]

History

The company was originally launched in 2010 as a car research site, Carbuzz. It offered aggregated expert reviews, user reviews, statistics, videos and images to help consumers looking to purchase a new car find the best vehicle for their taste, budget and requirements.[11]

In May 2013, it was re-launched as a car-buying platform. The company then raised £1.3m in venture capital finance from Balderton Capital, Episode 1 Ventures and Samos Investments, and several angel investors, including Alex Chesterman and Simon Murdoch, in February 2014 to fund growth.[12]

In 2014, its investors provided a further £4.6m of capital so the company could 'expand the team further, roll out above-the-line advertising campaigns and start exploring new markets'.[13]

In August 2015, following a complaint from a competitor, the Advertising Standards Authority found that the competitor "had been providing the same service since 2003", and therefore, the ASA "told Carwow not to claim that they were the first or only company to offer the advertised service."[14]

In January 2016, Carwow raised a further £12.5m in a Series B funding round led by Accel Partners.[15]

A £6m TV advertising campaign for Carwow was launched in December 2015, voiced by actor Michael Gambon.[16]

In August 2019, Carwow announced a £25 million strategic funding round led by German car manufacturer Daimler, the parent company of the Mercedes-Benz brand. Daimler executive Axel Harries will also sit on the Carwow board of directors.[17]

In June 2021, Carwow acquired Wizzle, a consumer-to-business car-buying platform founded by entrepreneur Sebastien Duval. Wizzle was rebranded Sell Your Car, allowing Carwow to grow the business significantly by entering the used car market.

In 2022, Volvo Cars acquired a minority stake in the company.[18]

In November 2022, Carwow cut nearly a fifth of its total staff due to economic concerns. Around 70 staff members were released across the UK, Spain and Germany.[19]

As of 12 July 2023 Carwow has multiple YouTube channels in various languages, presented by Mat Watson (or Daniel Hohmeyer for the German channel), with a combined total of 8.29 million subscribers and over 3.28 billion views on the English main channel.[20]

In 2022, ITV invested in a partnership with Carwow in return for advertising inventory across ITV’s channels and the ITV Hub. ITV acquired a minority stake in Carwow, valued at £2.5 million in return for advertising inventory, as part of a media for equity scheme, with an option to invest a further £2.5 million.[21][22][23]

In 2024, Carwow acquired Autovia, the publisher of former Dennis Publishing magazines Auto Express, Evo, DrivingElectric and Carbuyer.[24][25]

References

  1. ^ a b "About Carwow". YouTube.
  2. ^ "Can you save money buying a new car online through carwow?". BT.com. Retrieved 2016-02-18.
  3. ^ "Carwow raises $55m to invest in Sell Your Car service". 6 December 2021.
  4. ^ "Zoopla for cars: property site bosses back start-up carwow". Telegraph.co.uk. Retrieved 2016-02-18.
  5. ^ "Carwow YouTube subscribers leap to 2.7million". AMOnline. Retrieved 2019-04-25.
  6. ^ "Carwow and RAC partner to offer innovative new car-buying experience". Car Dealer Magazine. 3 June 2015. Retrieved 2016-02-18.
  7. ^ Beauhurst (2022-03-10). "50 Female Entrepreneurs To Watch | 2022". Beauhurst. Retrieved 2023-07-10.
  8. ^ "Inspirational Woman: Alex Margolis | Founder, www.carwow.co.uk". WeAreTheCity. 2016-12-13. Retrieved 2023-07-10.
  9. ^ O'Hear, Steve. "Car Buying Platform Carwow Raises £12.5M Series B Led by Accel". TechCrunch. Retrieved 2016-02-18.
  10. ^ "carwow celebrates one million users and £550m worth of cars sold - Startups 100 by Startups.co.uk: Start up a successful business". startups.co.uk. 26 January 2016. Retrieved 2016-02-18.
  11. ^ Love, Martin (2010-11-27). "Car review: Porsche Cayenne S Hybrid". The Guardian. ISSN 0261-3077. Retrieved 2016-02-18.
  12. ^ O'Hear, Steve. "Balderton Capital Leads £1.3M Seed In UK Car Buying Platform Carwow". TechCrunch. Retrieved 2016-02-18.
  13. ^ O'Hear, Steve. "Car Buying Platform Carwow Secures £4.6M Series A To Step On The Gas". TechCrunch. Retrieved 2016-02-18.
  14. ^ "ASA Ruling on Digital Blurb Ltd t/a Carwow". Advertising Standards Authority. 25 November 2015. Retrieved 29 November 2019.
  15. ^ "London startup Carwow has raised £12.5 million from the investors behind Dropbox and Spotify". Business Insider. Retrieved 2016-02-18.
  16. ^ "Michael Gambon to become the voice of Carwow". AMOnline. Retrieved 2016-02-18.
  17. ^ "Daimler leads £25 million strategic financing round for London-based car marketplace Carwow".
  18. ^ "Volvo takes stake in Carwow to help boost digital sales". Financial Times. 26 April 2022.
  19. ^ "Online car sales platform Carwow sheds a fifth of staff". Financial Times. 2022-11-25. Retrieved 2023-02-06.
  20. ^ "carwow's YouTube Stats". Socialblade. 19 May 2023. Retrieved 19 May 2023.
  21. ^ "ITV announces investment in Carwow". ITV Media. Retrieved 2023-07-10.
  22. ^ "ITV and Channel 4 drive £17.2m Carwow investment round". AMOnline. Retrieved 2023-07-10.
  23. ^ "ITV invests £2.5m stake in Carwow as part of media-for-equity scheme". campaignlive.co.uk. Retrieved 2023-07-10.
  24. ^ Kirwan, John (14 February 2024). "Carwow buys Autovia print and digital business for undisclosed sum". Motor Trader. Retrieved 8 June 2024.
  25. ^ "CARWOW ACQUIRES LEADING AUTOMOTIVE TITLES" (Press release). London, United Kingdom: Carwow Ltd. 2024-02-14. Retrieved 2024-11-12.

Read other articles:

This is a list of regents (Greek: αντιβασιλείς, sing. αντιβασιλεύς) in the modern Kingdom of Greece (1832–1924 and 1935–1973). A regent, from the Latin regens one who reigns, is a person selected to act as head of state (ruling or not) because the ruler is a minor, not present, or debilitated.[1] Reign of Otto Image Name Regency start Regency end Regency Council during the minority of King Otto. First Regency Council:Josef Ludwig von Armansperg, Carl Wilhe...

 

  لمعانٍ أخرى، طالع ديفيد ويب (توضيح). ديفيد ويب معلومات شخصية الميلاد 9 أبريل 1946 (العمر 77 سنة)لندن  الطول 5 قدم 11 بوصة (1.80 م)[1][1] مركز اللعب ظهير  [لغات أخرى]‏  الجنسية المملكة المتحدة  المسيرة الاحترافية1 سنوات فريق م. (هـ.) 1963–1966 ليتون أورين�...

 

Sebuah perhitungan Indeks Pembangunan Manusia (IPM) yang menggunakan metode baru dilaksanakan oleh Badan Pusat Statistik (BPS) dari tahun 2010 hingga sekarang. Berikut ini akan disajikan penjelasan, dimensi dasar, manfaat, dan metodologi perhitungan IPM, serta daftar kabupaten dan kota Jawa Barat menurut IPM tahun 2016. Penjelasan Indeks Pembangunan Manusia (IPM)/Human Development Index (HDI) adalah pengukuran perbandingan dari harapan hidup, melek huruf, pendidikan dan standar hidup untuk se...

Georges Clemenceau 72nd Prime Minister of FranceMasa jabatan25 October 1906 – 24 July 1909PresidenArmand FallièresPendahuluFerdinand SarrienPenggantiAristide Briand85th Prime Minister of FranceMasa jabatan16 November 1917 – 20 January 1920PresidenRaymond PoincaréPendahuluPaul PainlevéPenggantiAlexandre Millerand Informasi pribadiLahir28 September 1841Meninggal24 November 1929(1929-11-24) (umur 88)Partai politikRadicalProfesiPhysician, newspaper publisherSunting k...

 

PierrycomunePierry – Veduta LocalizzazioneStato Francia RegioneGrand Est Dipartimento Marna ArrondissementÉpernay CantoneÉpernay-2 TerritorioCoordinate49°01′N 3°56′E / 49.016667°N 3.933333°E49.016667; 3.933333 (Pierry)Coordinate: 49°01′N 3°56′E / 49.016667°N 3.933333°E49.016667; 3.933333 (Pierry) Superficie5,15 km² Abitanti1 232[1] (2009) Densità239,22 ab./km² Altre informazioniCod. postale51530 Fuso orario...

 

يوسف النبهاني معلومات شخصية الميلاد 1265 هـ/ 1849إجزم (حيفا)،  فلسطين الوفاة 1350 هـ/ 1932بيروت،  لبنان مكان الدفن مقبرة الباشورة مواطنة الدولة العثمانية  الديانة الإسلام المذهب الفقهي الشافعي العقيدة أهل السنة والجماعة عائلة طيء الحياة العملية المدرسة الأم جامعة الأزهر&#...

Late 8th-century–1215 Iranian dynasty from Ghor, modern Afghanistan Ghurid dynasty786–12151203KHWARAZMIANEMPIREKIPCHAKSABBASIDCALIPHATEZENGIDSYADAVASPARA-MARASCHANDELASQOCHOQARA KHITAIKARA-KHANIDS ◁ ▷ Map of Ghurid territory, before the assassination of Muhammad of Ghor.[1][2][3] In the west, Ghurid territory extended to Nishapur and Merv,[4][5] while Ghurid troops reached as far as Gorgan on the shores of the Caspian Sea.[6][7] ...

 

Stéphane GrappelliStéphane Grappelli nel 1976 (fotografia di Allan Warren) Nazionalità Francia Italia GenereJazzSwing Periodo di attività musicale1917 – 1977 Strumentoviolino, pianoforte GruppiQuintette du Hot Club de France Modifica dati su Wikidata · Manuale Stéphane Grappelli, nato Stefano Grappelli (Parigi, 26 gennaio 1908 – Parigi, 1º dicembre 1997), è stato un violinista, pianista e compositore francese, di origine italiana. Indice 1 Biograf...

 

La rilevanza enciclopedica di questa voce o sezione sull'argomento giornalisti è stata messa in dubbio. Motivo: voce creata sull'onda dell'eco mediatica di un gossip, su un professionista che non pare essersi particolarmente distinto, a parte essere il compagno di. Puoi aiutare aggiungendo informazioni verificabili e non evasive sulla rilevanza, citando fonti attendibili di terze parti e partecipando alla discussione. Se ritieni la voce non enciclopedica, puoi proporne la cancellazione...

Turkish footballer and manager Rebii Erkal Rebii Erkal (10 February 1911 – 25 November 1985) was a Turkish footballer and manager. He was born in Istanbul. Erkal played for Galatasaray SK his whole career, making him memorable for many Gala supporters. He was also part of Turkey's squad at the 1936 Summer Olympics.[1] In 1951, after his active playing career ended, he became the manager of the Turkey national football team. Under Erkal's charge, the national squad managed to defeat ...

 

Alexander Vasyunov Lahir (1988-04-22)22 April 1988Yaroslavl, Uni Soviet Wafat 7 September 2011(2011-09-07) (umur 23)dekat Yaroslavl, Rusia Tinggi 6 ft 0 in (183 cm) Berat 189 pon (86 kg; 13 st 7 pon) Posisi Sayap kiri Shot Right Bermain untuk Lokomotiv Yaroslavl (RSL)/(KHL)Lowell Devils (AHL)New Jersey Devils Tim nasional  Rusia NHL Draft 58th overall, 2006New Jersey Devils Karier bermain 2005–2011 Alexander Vasyunov Rekam medali Mewakili &#...

 

Form of direct action Benjamin Cowins during a 1961 sit-in at McCrory's lunch counter in Tallahassee A sit-in for climate action in Melbourne, Australia Human rights sit-in at the Taiwanese executive assembly A sit-in or sit-down is a form of direct action that involves one or more people occupying an area for a protest, often to promote political, social, or economic change. The protestors gather conspicuously in a space or building, refusing to move unless their demands are met. The often c...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Azuqueca de Henares – news · newspapers · books · scholar · JSTOR (July 2014) (Learn how and when to remove this message) Place in Castile-La Mancha, SpainAzuqueca de Henares SealAzuqueca de HenaresSan Miguel's ChurchShow map of Province of GuadalajaraAzuqueca ...

 

Basilika Santo MaksellendusBasilika Minor Santo Maksellendusbahasa Prancis: Basilique Sainte-Maxellende de CaudryBasilika Santo MaksellendusWikipedia | Kode sumber | Tata penggunaan Koordinat: 50°7′26.51″N 3°24′30.99″E / 50.1240306°N 3.4086083°E / 50.1240306; 3.4086083LokasiCaudryNegaraPrancisDenominasiGereja Katolik RomaArsitekturStatusBasilika minorStatus fungsionalAktif Basilika Santo Maksellendus (bahasa Prancis: Basilique Sainte-Maxellende de C...

 

Metaphorical place of seclusion For other uses, see Ivory Tower (disambiguation). Hawksmoor Towers are representative of the stereotypical academic ivory towers, at All Souls College, Oxford at the University of Oxford An ivory tower is a state of privileged seclusion from the practicalities of real life. An ivory tower can be a place where people choose to disconnect from the rest of the world to follow of their own interests, usually mental or esoteric ones. From the 19th century, it has be...

United English and Scottish parliament 1707–1800 This article is about the historical parliament in existence from 1707 to 1800. For its present-day successor, see Parliament of the United Kingdom. Parliament of the Kingdom of Great BritainRoyal coat of arms of Great Britain, 1714–1800TypeTypeBicameral HousesHouse of LordsHouse of CommonsHistoryEstablished1 May 1707Disbanded31 December 1800Preceded byParliament of EnglandParliament of ScotlandSucceeded byParliament of the United...

 

Public research university in Brisbane, Australia UQ and Queensland University redirect here. For other universities in Queensland, see Queensland § Education. For other uses, see UQ (disambiguation). The University of QueenslandCoat of armsLatin: Terrae Reginae UniversitasMotto Scientia ac Labore (Latin) Motto in EnglishBy means of knowledge and hard work[1]TypePublic research universityEstablished10 December 1909; 114 years ago (1909-12-10)[2]Acc...

 

Philosophy in the Roman world, influenced by Hellenistic philosophy Roman philosophy redirects here. For philosophy in (lands descended from) the Western Roman Empire, see Latin philosophy (disambiguation). For philosophy in the Eastern Roman Empire, see Byzantine philosophy. Part of a series onPhilosophy Philosophy portal Contents Outline Lists Glossary History Categories Philosophies By period Ancient Ancient Egyptian Ancient Greek Medieval Renaissance Modern Contemporary Analytic Conti...

Species of lemur Betsileo woolly lemur Conservation status Endangered  (IUCN 3.1)[1] CITES Appendix I (CITES)[2] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Mammalia Order: Primates Suborder: Strepsirrhini Family: Indriidae Genus: Avahi Species: A. betsileo Binomial name Avahi betsileoAndriantompohavana et al., 2007[3] Distribution of A. betsileo[1] The Betsileo woolly lemur or Betsileo avahi (Avahi ...

 

1991 Ålandic legislative election ← 1987 20 October 1991 1995 → All 30 seats in the Parliament of Åland16 seats needed for a majorityTurnout62.37% ( 1.97 pp) Party Leader Vote % Seats +/– Åland Centre Ragnar Erlandsson 30.16 10 +1 Liberals for Åland Sune Eriksson 22.90 7 −1 Freeminded Co-op 19.81 6 +1 Social Democrats 14.55 4 0 Non-aligned Coalition 9.74 3 +1 This lists parties that won seats. See the complete results below. Lantråd before Lantråd after Su...