Carwow
|
Read other articles:
This is a list of regents (Greek: αντιβασιλείς, sing. αντιβασιλεύς) in the modern Kingdom of Greece (1832–1924 and 1935–1973). A regent, from the Latin regens one who reigns, is a person selected to act as head of state (ruling or not) because the ruler is a minor, not present, or debilitated.[1] Reign of Otto Image Name Regency start Regency end Regency Council during the minority of King Otto. First Regency Council:Josef Ludwig von Armansperg, Carl Wilhe...
لمعانٍ أخرى، طالع ديفيد ويب (توضيح). ديفيد ويب معلومات شخصية الميلاد 9 أبريل 1946 (العمر 77 سنة)لندن الطول 5 قدم 11 بوصة (1.80 م)[1][1] مركز اللعب ظهير [لغات أخرى] الجنسية المملكة المتحدة المسيرة الاحترافية1 سنوات فريق م. (هـ.) 1963–1966 ليتون أورين�...
Sebuah perhitungan Indeks Pembangunan Manusia (IPM) yang menggunakan metode baru dilaksanakan oleh Badan Pusat Statistik (BPS) dari tahun 2010 hingga sekarang. Berikut ini akan disajikan penjelasan, dimensi dasar, manfaat, dan metodologi perhitungan IPM, serta daftar kabupaten dan kota Jawa Barat menurut IPM tahun 2016. Penjelasan Indeks Pembangunan Manusia (IPM)/Human Development Index (HDI) adalah pengukuran perbandingan dari harapan hidup, melek huruf, pendidikan dan standar hidup untuk se...
Georges Clemenceau 72nd Prime Minister of FranceMasa jabatan25 October 1906 – 24 July 1909PresidenArmand FallièresPendahuluFerdinand SarrienPenggantiAristide Briand85th Prime Minister of FranceMasa jabatan16 November 1917 – 20 January 1920PresidenRaymond PoincaréPendahuluPaul PainlevéPenggantiAlexandre Millerand Informasi pribadiLahir28 September 1841Meninggal24 November 1929(1929-11-24) (umur 88)Partai politikRadicalProfesiPhysician, newspaper publisherSunting k...
PierrycomunePierry – Veduta LocalizzazioneStato Francia RegioneGrand Est Dipartimento Marna ArrondissementÉpernay CantoneÉpernay-2 TerritorioCoordinate49°01′N 3°56′E / 49.016667°N 3.933333°E49.016667; 3.933333 (Pierry)Coordinate: 49°01′N 3°56′E / 49.016667°N 3.933333°E49.016667; 3.933333 (Pierry) Superficie5,15 km² Abitanti1 232[1] (2009) Densità239,22 ab./km² Altre informazioniCod. postale51530 Fuso orario...
يوسف النبهاني معلومات شخصية الميلاد 1265 هـ/ 1849إجزم (حيفا)، فلسطين الوفاة 1350 هـ/ 1932بيروت، لبنان مكان الدفن مقبرة الباشورة مواطنة الدولة العثمانية الديانة الإسلام المذهب الفقهي الشافعي العقيدة أهل السنة والجماعة عائلة طيء الحياة العملية المدرسة الأم جامعة الأزهر...
Late 8th-century–1215 Iranian dynasty from Ghor, modern Afghanistan Ghurid dynasty786–12151203KHWARAZMIANEMPIREKIPCHAKSABBASIDCALIPHATEZENGIDSYADAVASPARA-MARASCHANDELASQOCHOQARA KHITAIKARA-KHANIDS ◁ ▷ Map of Ghurid territory, before the assassination of Muhammad of Ghor.[1][2][3] In the west, Ghurid territory extended to Nishapur and Merv,[4][5] while Ghurid troops reached as far as Gorgan on the shores of the Caspian Sea.[6][7] ...
Stéphane GrappelliStéphane Grappelli nel 1976 (fotografia di Allan Warren) Nazionalità Francia Italia GenereJazzSwing Periodo di attività musicale1917 – 1977 Strumentoviolino, pianoforte GruppiQuintette du Hot Club de France Modifica dati su Wikidata · Manuale Stéphane Grappelli, nato Stefano Grappelli (Parigi, 26 gennaio 1908 – Parigi, 1º dicembre 1997), è stato un violinista, pianista e compositore francese, di origine italiana. Indice 1 Biograf...
La rilevanza enciclopedica di questa voce o sezione sull'argomento giornalisti è stata messa in dubbio. Motivo: voce creata sull'onda dell'eco mediatica di un gossip, su un professionista che non pare essersi particolarmente distinto, a parte essere il compagno di. Puoi aiutare aggiungendo informazioni verificabili e non evasive sulla rilevanza, citando fonti attendibili di terze parti e partecipando alla discussione. Se ritieni la voce non enciclopedica, puoi proporne la cancellazione...
Turkish footballer and manager Rebii Erkal Rebii Erkal (10 February 1911 – 25 November 1985) was a Turkish footballer and manager. He was born in Istanbul. Erkal played for Galatasaray SK his whole career, making him memorable for many Gala supporters. He was also part of Turkey's squad at the 1936 Summer Olympics.[1] In 1951, after his active playing career ended, he became the manager of the Turkey national football team. Under Erkal's charge, the national squad managed to defeat ...
Alexander Vasyunov Lahir (1988-04-22)22 April 1988Yaroslavl, Uni Soviet Wafat 7 September 2011(2011-09-07) (umur 23)dekat Yaroslavl, Rusia Tinggi 6 ft 0 in (183 cm) Berat 189 pon (86 kg; 13 st 7 pon) Posisi Sayap kiri Shot Right Bermain untuk Lokomotiv Yaroslavl (RSL)/(KHL)Lowell Devils (AHL)New Jersey Devils Tim nasional Rusia NHL Draft 58th overall, 2006New Jersey Devils Karier bermain 2005–2011 Alexander Vasyunov Rekam medali Mewakili ...
Form of direct action Benjamin Cowins during a 1961 sit-in at McCrory's lunch counter in Tallahassee A sit-in for climate action in Melbourne, Australia Human rights sit-in at the Taiwanese executive assembly A sit-in or sit-down is a form of direct action that involves one or more people occupying an area for a protest, often to promote political, social, or economic change. The protestors gather conspicuously in a space or building, refusing to move unless their demands are met. The often c...
This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Azuqueca de Henares – news · newspapers · books · scholar · JSTOR (July 2014) (Learn how and when to remove this message) Place in Castile-La Mancha, SpainAzuqueca de Henares SealAzuqueca de HenaresSan Miguel's ChurchShow map of Province of GuadalajaraAzuqueca ...
Basilika Santo MaksellendusBasilika Minor Santo Maksellendusbahasa Prancis: Basilique Sainte-Maxellende de CaudryBasilika Santo MaksellendusWikipedia | Kode sumber | Tata penggunaan Koordinat: 50°7′26.51″N 3°24′30.99″E / 50.1240306°N 3.4086083°E / 50.1240306; 3.4086083LokasiCaudryNegaraPrancisDenominasiGereja Katolik RomaArsitekturStatusBasilika minorStatus fungsionalAktif Basilika Santo Maksellendus (bahasa Prancis: Basilique Sainte-Maxellende de C...
Metaphorical place of seclusion For other uses, see Ivory Tower (disambiguation). Hawksmoor Towers are representative of the stereotypical academic ivory towers, at All Souls College, Oxford at the University of Oxford An ivory tower is a state of privileged seclusion from the practicalities of real life. An ivory tower can be a place where people choose to disconnect from the rest of the world to follow of their own interests, usually mental or esoteric ones. From the 19th century, it has be...
United English and Scottish parliament 1707–1800 This article is about the historical parliament in existence from 1707 to 1800. For its present-day successor, see Parliament of the United Kingdom. Parliament of the Kingdom of Great BritainRoyal coat of arms of Great Britain, 1714–1800TypeTypeBicameral HousesHouse of LordsHouse of CommonsHistoryEstablished1 May 1707Disbanded31 December 1800Preceded byParliament of EnglandParliament of ScotlandSucceeded byParliament of the United...
Public research university in Brisbane, Australia UQ and Queensland University redirect here. For other universities in Queensland, see Queensland § Education. For other uses, see UQ (disambiguation). The University of QueenslandCoat of armsLatin: Terrae Reginae UniversitasMotto Scientia ac Labore (Latin) Motto in EnglishBy means of knowledge and hard work[1]TypePublic research universityEstablished10 December 1909; 114 years ago (1909-12-10)[2]Acc...
Philosophy in the Roman world, influenced by Hellenistic philosophy Roman philosophy redirects here. For philosophy in (lands descended from) the Western Roman Empire, see Latin philosophy (disambiguation). For philosophy in the Eastern Roman Empire, see Byzantine philosophy. Part of a series onPhilosophy Philosophy portal Contents Outline Lists Glossary History Categories Philosophies By period Ancient Ancient Egyptian Ancient Greek Medieval Renaissance Modern Contemporary Analytic Conti...
Species of lemur Betsileo woolly lemur Conservation status Endangered (IUCN 3.1)[1] CITES Appendix I (CITES)[2] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Mammalia Order: Primates Suborder: Strepsirrhini Family: Indriidae Genus: Avahi Species: A. betsileo Binomial name Avahi betsileoAndriantompohavana et al., 2007[3] Distribution of A. betsileo[1] The Betsileo woolly lemur or Betsileo avahi (Avahi ...
1991 Ålandic legislative election ← 1987 20 October 1991 1995 → All 30 seats in the Parliament of Åland16 seats needed for a majorityTurnout62.37% ( 1.97 pp) Party Leader Vote % Seats +/– Åland Centre Ragnar Erlandsson 30.16 10 +1 Liberals for Åland Sune Eriksson 22.90 7 −1 Freeminded Co-op 19.81 6 +1 Social Democrats 14.55 4 0 Non-aligned Coalition 9.74 3 +1 This lists parties that won seats. See the complete results below. Lantråd before Lantråd after Su...