Share to: share facebook share twitter share wa share telegram print page

Daftar tokoh Sulawesi Utara

Halaman ini berisi daftar tokoh yang berasal dari Provinsi Sulawesi Utara atau orang Sulawesi Utara yang ada di daerah lain yang umumnya dikenal oleh Masyarakat di Provinsi Sulawesi Utara. Pembaca dapat berkontribusi untuk mengembangkannya.

Presiden Negara Kesatuan Republik Indonesia

Agamawan


Ahli Hukum

Akademisi dan Ahli

Aktivis dan Pejuang

Pemimpin Pasukan Tulungen van Minahasa

Perang Minahasa melawan Spanyol

Perang Minahasa melawan Vereenigde Oostindische Compagnie

Artis

Atlet

Ibu Negara

Jurnalis

Menteri dan Pejabat Tinggi Negara


Militer dan Kepolisian

Pahlawan Nasional

  • Arie Frederik Lasut adalah seorang Pahlawan Nasional Indonesia dan ahli pertambangan dan geologis. Dia terlibat dalam perang kemerdekaan Indonesia dan pengembangan sumber daya pertambangan dan geologis pada saat-saat permulaan negara Republik Indonesia. Lasut dilahirkan di desa Kapataran, yang sekarang berada di kabupaten Minahasa, provinsi Sulawesi Utara. Dia adalah putera tertua dari delapan anak dari Darius Lasut dan Ingkan Supit. Adiknya yang bernama Willy Lasut sempat menjabat sebagai Gubernur Sulawesi Utara.
  • Alexander Andries Maramis, Dr. (H.C.) Mr. Alexander Andries Maramis atau lebih dikenal dengan A.A. Maramis (20 Juni 1897 – 31 Juli 1977) adalah pejuang kemerdekaan Indonesia dan pahlawan nasional. Dia pernah menjadi anggota BPUPKI dan KNIP. Ia juga pernah menjadi Menteri Keuangan Indonesia dan merupakan orang yang menandatangani Oeang Republik Indonesia pertama
  • Arnold Mononutu, adalah pahlawan nasional yang pernah menjabat sebagai Menteri Penerangan, anggota Majelis Konstituante, dan rektor Universitas Hasanuddin. Selain itu ia adalah Duta Besar Indonesia pertama untuk Tiongkok
  • Bernard Wilhelm Lapian adalah seorang pejuang nasionalis berasal dari Minahasa, Sulawesi Utara. Perjuangannya dilakukan dalam berbagai bidang dan dalam rentang waktu sejak zaman pemerintahan Hindia Belanda, pendudukan Jepang, sampai pada zaman kemerdekaan Indonesia.
  • Daan Mogot, Pahlawan Nasional, Pendiri dan Direktur I Akademi Militer
  • John Lie Tjeng Tjoan, Pejuang Kemerdekaan, Militer
  • Joop Warouw, Pejuang Kemerdekaan
  • Lambertus Nicodemus Palar adalah seorang diplomat dan politisi Indonesia. Ia pernah menjabat sebagai duta besar Indonesia untuk Perserikatan Bangsa-Bangsa, India, Jerman Timur, Uni Soviet, Kanada, dan Amerika Serikat.
  • Maria Walanda Maramis, Pejuang Kemajuan dan Emansipasi Wanita
  • Pierre Tendean, Pahlawan Revolusi, Ajudan Jenderal A.H. Nasution
  • Robert Wolter Monginsidi, Pejuang Kemerdekaan Indonesia, Guru
  • Sam Ratulangi, Pejuang Kemerdekaan Indonesia, Ahli Matematik dan Fisika
  • Frans Mendur, Pahlawan Nasional, Fotografer pada masa kemerdekaan RI
  • Alex Mendur, Pahlawan Nasional, Fotografer pada masa kemerdekaan RI
  • Dece Endey. Pejuang di Jawa Barat asal Sulawesi Utara

Pengusaha dan Profesional


Politisi

Sastrawan dan Penulis

Sutradara, Seniman dan Budayawan

Lain-lain

Lihat pula

Referensi

  1. ^ http://mongondow.com/hadidjah-lena-mokoginta/
  2. ^ https://instagram.com/stvsmnti?igshid=YmMyMTA2M2Y=.  Tidak memiliki atau tanpa |title= (bantuan)
  3. ^ https://instagram.com/ernestokandouw?igshid=YmMyMTA2M2Y=.  Tidak memiliki atau tanpa |title= (bantuan)
  4. ^ https://instagram.com/geralpandelaki99?igshid=YmMyMTA2M2Y=.  Tidak memiliki atau tanpa |title= (bantuan)
  5. ^ https://instagram.com/jeremyslr?igshid=YmMyMTA2M2Y=.  Tidak memiliki atau tanpa |title= (bantuan)
  6. ^ "1". Diarsipkan dari versi asli tanggal 2014-03-05. Diakses tanggal 2014-03-03. 

Read other articles:

Kongres Amerika Serikat ke-100Gedung Kapitol (2002)Periode3 Januari 1987 – 3 Januari 1989Anggota100 senator435 anggota dewan5 delegasi tanpa suaraMayoritas SenatPartai DemokratPresiden SenatGeorge H. W. Bush (R)Mayoritas DPRPartai DemokratKetua DPRJim Wright (D)Pres. Senat Pro TemporeJohn C. Stennis (D)Sesike-1: 6 Januari 1987 – 22 Desember 1987ke-2: 25 Januari 1988 – 22 Oktober 1988ke-99 ←→ ke-101 Kongres Amerika Serikat ke-100 adalah sebuah pertemuan cabang legislatif …

FeuerwehrBelgien Notruf: 112 Personal Aktive(ohne Jugend): 17300 Freiwilligenquote: 71 % Stützpunkte Gesamtanzahl: 270 Die Feuerwehr in Belgien (niederländisch: Brandweerdienst, französisch: Service d'Incendie) ist in Hilfeleistungszonen aufgeteilt, welche die Arbeit der Berufs- und freiwilligen Feuerwehrleute in Belgien organisieren. Hilfeleistungszonen der Feuerwehr in Belgien Inhaltsverzeichnis 1 Allgemeines 2 Ausbildung 3 Gesetzliche Grundlage 4 Geschichte 5 Technik und Einsatztaktik…

2000 video game 2000 video gameStar Trek: Deep Space Nine: The FallenDeveloper(s)The CollectivePublisher(s)Simon & SchusterEngineUnreal Engine[6]Platform(s)Microsoft Windows, Mac OSReleaseWindowsNA: November 13, 2000[2][3][4]EU: November 17, 2000[1]MacWW: August 1, 2001[5]Genre(s)Third-person shooterMode(s)Single-player Star Trek: Deep Space Nine: The Fallen is a 2000 third-person shooter video game developed by The Collective and published by …

منتخب السويد تحت 17 سنة لكرة القدم للسيدات بلد الرياضة السويد  الفئة كرة قدم تحت 17 سنة للسيدات  [لغات أخرى]‏  رمز الفيفا SWE  الموقع الرسمي الموقع الرسمي  مشاركات تعديل مصدري - تعديل   منتخب السويد تحت 17 سنة للسيدات لكرة القدم (بالسويدية: Sveriges U17-damlandslag i fotboll)‏

Опис файлу Обґрунтування добропорядного використання для статті «Торкнися Зена» [?] Опис Постер фільму Торкнися Зена Джерело http://www.hkcinemagic.com/en/gallery.asp?fid=1103&id=8940#pic Автор невідомо Час створення 1971 Мета використання Для ілюстрації статті про фільм чи захід. Допомагає …

Artikel ini perlu diwikifikasi agar memenuhi standar kualitas Wikipedia. Anda dapat memberikan bantuan berupa penambahan pranala dalam, atau dengan merapikan tata letak dari artikel ini. Untuk keterangan lebih lanjut, klik [tampil] di bagian kanan. Mengganti markah HTML dengan markah wiki bila dimungkinkan. Tambahkan pranala wiki. Bila dirasa perlu, buatlah pautan ke artikel wiki lainnya dengan cara menambahkan [[ dan ]] pada kata yang bersangkutan (lihat WP:LINK untuk keterangan lebih lanjut). …

Statue of Metallurgist AnosovStatue of Metallurgist Anosov on the Third International Square in Zlatoust, Urals Military District, was erected on 15 December 1954. By Moscow sculptors A.P. Antropov and N.L. Strain and architect T.L. Shulgina.ArtistA.P. Antropov, N.L. Shtamm, and T.L. ShulginaYear1954 (1954)MediumBronzeSubjectAnosov Pavel PetrovichDimensions9.5 m (31 ft)LocationZlatoust, Chelyabinsk Oblast The Statue of Metallurgist Anosov in Zlatoust city is situated on the ma…

Lijst van bruggen in het Amsterdamse stadsdeel Noord, dat is het deel van de gemeente Amsterdam ten noorden van het IJ, inclusief de dorpen Durgerdam, Zunderdorp, Ransdorp en Holysloot. Belangrijke verkeersbruggen De Schellingwouderbrug tussen Schellingwoude en het Zeeburgereiland is de enige brug tussen Amsterdam-Noord en de rest van de stad. Gerben Wagenaarbrug Bruggen in het westelijk deel van Noord (postcodes 1031-1037): Theo Fransmanbrug (brug 1788), fietsbrug over Zijkanaal I bij NDSM-werf…

رحلة فضائية تاريخ رحلات الفضاء سباق الفضاء تسلسل زمني لارتياد الفضاء قائمة مسابير المجموعة الشمسية رحلة فضائية قمر صناعي لرصد الأرض قمر استطلاع قمر صناعي للاتصالات الملاحة عبر الأقمار الصناعية مرصد فضائي استكشاف الفضاء سياحة الفضاء استعمار الفضاء مركبة فضائية مركبة فضائ

  لمعانٍ أخرى، طالع سلعة (توضيح).   هذه المقالة عن البضاعة أو ما يتم تداوله اقتصاديا في البيع والشراء. لمعانٍ أخرى، طالع سلعة (طب). بضاعةمعلومات عامةصنف فرعي من goods and services (en) منتج يدرس بواسطة اقتصاد النقيض bad (en) تعديل - تعديل مصدري - تعديل ويكي بيانات أنواع السلع في الاق…

Este artículo o sección necesita referencias que aparezcan en una publicación acreditada.Este aviso fue puesto el 26 de junio de 2014. Fuerzas Armadas de Jordania Vehículo de combate de las Fuerzas Armadas de Jordania.Activa octubre de 1920País  JordaniaFidelidad rey de JordaniaTipo fuerzas armadasAcuartelamiento Amánhttp://www.jaf.mil.jo[editar datos en Wikidata] Las Fuerzas Armadas de Jordania (en árabe: القوات المسلحة الأردنية), con todas sus ramas, …

Місяць у культурі — використання образу природного супутника планети Земля в культурі. Люди з самого початку своєї появи спостерігають за Місяцем — єдиним природним супутником Землі, який завдяки своєму розміру так само добре видно на небі, як і Сонце. Втім, на відмі…

Volcán de Agua Volcán de Agua, visto desde la ciudad de Antigua Guatemala.Localización geográficaContinente AméricaCordillera Sierra Madre de ChiapasCoordenadas 14°27′54″N 90°44′34″O / 14.465, -90.742777777778Localización administrativaPaís Guatemala GuatemalaDivisión Departamento de Sacatepéquez Departamento de EscuintlaCaracterísticas generalesTipo EstratovolcanoAltitud 3760 m s. n. m.[1]​GeologíaObservatorio Instituto Nacional de Sismología, Vu…

1972 compilation album Simon and Garfunkel's Greatest HitsGreatest hits album by Simon & GarfunkelReleasedJune 14, 1972 (1972-06-14)RecordedMarch 1964–November 1969GenreFolk rockLength43:25LabelColumbiaProducerPaul SimonArt GarfunkelRoy HaleeSimon & Garfunkel chronology Bridge over Troubled Water(1970) Simon and Garfunkel's Greatest Hits(1972) Collected Works(1981) Simon and Garfunkel's Greatest Hits is the first compilation album from Simon & Garfunkel, which wa…

Wapen van Benschop Het wapen van Benschop werd op 11 september 1816 door de Hoge Raad van Adel aan de Utrechtse gemeente Benschop bevestigd. In 1989 ging Benschop op in de gemeente Lopik. Het wapen van Benschop is daardoor komen te vervallen als gemeentewapen. In het wapen van Lopik van 1990 is de dwarsbalk uit het wapen van Benschop opgenomen. Hoewel de schuinbalk ook voorkomt in het wapen van Lopik wordt deze niet afkomstig geacht uit het wapen van Benschop, maar uit het wapen van Polsbroek om…

National park in Slovenia Triglav National ParkIUCN category V (protected landscape/seascape)TriglavLocationSloveniaCoordinates46°20′N 13°46′E / 46.333°N 13.767°E / 46.333; 13.767Area880 km2 (340 sq mi)[1][2]Established1981[3]Visitors1.6 million (in 2006) The Tamar Valley Triglav National Park (TNP) (Slovene: Triglavski narodni park) is the only national park in Slovenia. It was established in its modern form in 1981…

66th season in franchise history; final one with Andrew Luck 2018 Indianapolis Colts seasonOwnerJim IrsayGeneral managerChris BallardHead coachFrank ReichHome fieldLucas Oil StadiumResultsRecord10–6Division place2nd AFC SouthPlayoff finishWon Wild Card Playoffs(at Texans) 21–7Lost Divisional Playoffs(at Chiefs) 13–31Pro BowlersQB Andrew Luck TE Eric Ebron G Quenton NelsonUniform ← 2017 Colts seasons 2019 → The 2018 season was the Indianapolis Colts' 66th in the N…

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of the C…

30th episode of the 3rd season of The Twilight Zone Hocus-Pocus and FrisbyThe Twilight Zone episodeFrisby's AlienEpisode no.Season 3Episode 30Directed byLamont JohnsonStory byFrederic Louis FoxTeleplay byRod SerlingFeatured musicTommy MorganProduction code4833Original air dateApril 13, 1962 (1962-04-13)Guest appearancesAndy Devine: Frisby Milton Selzer: Alien #1 Larry Breitman: Alien #2 Peter Brocco: Alien #3 Howard McNear: Mitchell Dabbs Greer: Scanlan Clem Bevans: Old Man (…

1980 Italian filmZombie HolocaustItalian theatrical release posterDirected byMarino GirolamiScreenplay byRomano Scandariato[1]Story byFabrizio De Angelis[1]Starring Ian McCulloch Alexandra Delli Colli Sherry Buchanan Peter O'Neal Donald O'Brien CinematographyFausto Zuccoli[1]Edited byAlberto Moriani[1]Music byNico Fidenco[1]Productioncompanies Flora Film Fulvia Film Gico Cinematografica[1] Distributed byVariety DistributionRelease date 1980 (1…

Kembali kehalaman sebelumnya

Lokasi Pengunjung: 44.192.94.177